SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for KII73720 from Thelohanellus kitauei

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  KII73720
Domain Number 1 Region: 182-259,404-537
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 0.0000000000222
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) KII73720
Sequence length 625
Comment pep supercontig:ASM82789v1:scaffold04155:75666:79856:-1 gene:RF11_11018 transcript:KII73720 gene_biotype:protein_coding transcript_biotype:protein_coding description:hypothetical protein
Sequence
MENLNSTTNNQEEDTQNQNKTKEALILPKSNINYIREEISQNIVNIVTKIIPSHFMEFKQ
ILVNEELKESYQLSVERSKRKTIEKRVFLKIEYSFLQYLEEHRQFLPLLFIPVPLQAGHV
FNPVYNFNIRHNLRMFFVKKKQKHHLTSLCLIILIAGLAWRTIEDDDYAYYDPPPEMITK
KTIHDGNIEYHIYTNPHDNEFIFIISNSSIDQLQNVTPGLYVSNDGFRTFQVRHPKLNGQ
PIYTTHIISTKNHMFCISKINLTFYYIDKKLAQQHMHKYEENEDIIPHPTIEGYVLKMVP
ESSTKHIMLILDISNNYSEVVRHENVKGAMFLSDSSVLFQYTKRVNHFVNIHGHYYIEIR
DRDGVNCLFTSHDRSEYFIRLTCDLESETTGRTSVAFHPLLPGIIYANLKIGKNTYTHIS
MNYGKNFSAMKFIKKPSLCDDGSCHVKLNLPTITQNHQYFQKEWIAAFDIVDNFTIKHIG
RHLISFDGGQNWKSVPFSHFYAQILNQGGIAMGLNQNTRKIIYTFDEGNTYYHHNFYGPG
EVFVSGMKTGKLKNESFNSYDKIDRTCENDDYLPWDLPTENGLCFQGRNISYKKKKLSSL
CVDTEPYLKILTSKPCPCSLDDYRW
Download sequence
Identical sequences A0A0C2NBK7
KII73720

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]