SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for KII74668 from Thelohanellus kitauei

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  KII74668
Domain Number 1 Region: 77-242
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 0.000000288
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) KII74668
Sequence length 313
Comment pep supercontig:ASM82789v1:scaffold04403:22482:23467:-1 gene:RF11_11868 transcript:KII74668 gene_biotype:protein_coding transcript_biotype:protein_coding description:hypothetical protein
Sequence
MDLQNVKNYFASGSSILIVQQHNTQDQLNFVIWESPTNKTINIVLPILFHPRKVHQYIYA
HEQNYILVSNRRGAKCLFTSYDKSEYFVRITCQFDSIFSSEQCPIVVHPYLPGIIYANLR
DENNQLFTFVSVNDGRSFIPMRFENEKLQCPEKRCYIKLKIECKIQSNIQFPMEWMAIFQ
HQYNSKQPHLRQLVTFDGGITWKQTPFQNLQAIILNSGGLIVGVDSATREIAYSFDEGKK
WFHKDIINQDEKFVFLVPNGNYQKEFVSIIGLHKDSLYWVVSRVNFSNILSILTKNRPDM
PRARLYALEGTKT
Download sequence
Identical sequences A0A0C2JYQ0
KII74668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]