SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for KII61655 from Thelohanellus kitauei

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  KII61655
Domain Number 1 Region: 154-302
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 3.11e-24
Family Canonical RBD 0.005
Further Details:      
 
Domain Number 2 Region: 447-610
Classification Level Classification E-value
Superfamily SPOC domain-like 3.53e-20
Family SPOC domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) KII61655
Sequence length 612
Comment pep supercontig:ASM82789v1:scaffold03380-2:82647:84572:1 gene:RF11_08567 transcript:KII61655 gene_biotype:protein_coding transcript_biotype:protein_coding description:Protein split end
Sequence
MPNQRIYPPRISSDLPQASDLTPDSDEEVLNVYASLSNIDDSDNDVKSSILDQVTRYRNL
TVSIKKSDKSGRRFAVFTFDTPEALNYFKRAILEKRDRIIVGGHVLFFNFFNGNQDRSRG
GIHLRSRDHRSPRRRSRSTGSNDRGRGIRPQRSPDQTRTLFVGNLDEKLESDDIQRHFEP
FGEVIDIVVKHPPGDRSAPYAFVKYKQLSAALNARDKLQDTFIGQHRAKIGFGKASPTNV
IWIGGLNEKTTEEELADEIRRYSRFVDYQFFADQSVAYFLFDNLAQSRKVYSCLHHSRLR
NSGAILEIDYADPRKEAAGLVERNVQSPEHSVHANDRKERESSMSTERNDRSRKRKNPSR
SSSYGPPRKSPAPIRHRQGPHTPEGKPPGRHEIEFSESSSPQPRRLARDSGSANMVERDM
RNDVNRFNFGQKDSQPASFNNVTNKALVQILSYYPVVWKGGVAIKGQVTYVQLHLICGSV
DPVSTMVHQATLSGKDPQMINLTGRIPLTSDRVSDIKAKIATAISTKDCCISLAQQTILD
RGRDNHHSKPLSNVISYFQEKQAAGVDKIGISKMYVFAPSLFTQEQLITMMPHVTNILNA
SNDNYLMVMVTR
Download sequence
Identical sequences A0A0C2M3R7
KII61655

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]