SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for KII63327 from Thelohanellus kitauei

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  KII63327
Domain Number 1 Region: 511-702
Classification Level Classification E-value
Superfamily Sec7 domain 7.85e-64
Family Sec7 domain 0.00000843
Further Details:      
 
Domain Number 2 Region: 927-1327,1419-1590
Classification Level Classification E-value
Superfamily ARM repeat 0.000000000121
Family PBS lyase HEAT-like repeat 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) KII63327
Sequence length 1598
Comment pep supercontig:ASM82789v1:scaffold05491:19260:26095:-1 gene:RF11_15761 transcript:KII63327 gene_biotype:protein_coding transcript_biotype:protein_coding description:Brefeldin A-inhibited guanine nucleotide-exchange protein 2
Sequence
MNQHISNIRNYASQILAQKSSKCIKDQSLYEKLVYLQDLKNEDTYEIDEISIFEVLLQIL
DTGIVQLFVPTFDFFNQLILLNLTPKILPIVPTGSDQTYANIFVKRAYRILKDKAQTEVV
QLSVITVLVALLNLDCQHVPISCFFAIINILFEIHRTSKSRINQSAIRAALTSCVMNTFH
SSEDTQIKINKSPVRADSQSKDDETDNISQNDSECKSMNADMAHHETSQDTLSNQTVQER
EFESKIFEDNDENNLMQAFDEYRLDWNDKKLIRAFCIFHHICKSTIVTNITDAATKLTAI
PFVIFNMDLIVIALKSIELKTSTIHYFVELIKKYLFVSITQDLISSNEVLFRLSLEIFIL
LVEKFRSDLKCEIQHYFNCVLLSVIESSHCSFQTRHVFTTLVKLCSNAELMSFLFVNYDC
DMESLNIFERLIGNICKNAENPSFLTDKNASLTQATKHDLEFKIRSSCLSLLNNILLFIK
DVSESHKTVSIKSTQEIADEEAVKMSKISVSVFKERKDLLAQGVSLFNIKPKNGLEFLIA
NGFIEDSIEEIARFLKEEDRLNPDKIGELIGHENPKWIEVMNKYVENFNFKDMDFLEALR
LFLSEFRLPGEAQKIDRLMEKFASHYCKENKNNEMFKNADTAYFVAYSIIMLTTDLHNPL
VIRKITQQQYVMMNTNSDGTTNLPKDYLIKIYESIAANEITLRSKSVNNRSLVDFKEANL
SFDLSKMTKMSLSRTWVSKNQVSKLEEVEQSDAVKTMFCTIWNQVMVCFGWVLNETNYSS
LIYECLQGIRLSVRLACIYRLDFVRESLICSLIPFSIMNKKVKRIQDIQMKNVAVIKTIL
LIAKEDGQFLYNSWKDILPCISFMEFLQDVTSNKNKILNIKAPELDEISKSLSGFSLKSA
NFKSQFIYILEELSSQDLVVLMDQIFINSVKFDPEALMHLISCLCDAAKDELFQSKPPRI
FSLQKFLEVMYYNMDRTRIIWKNMWLILQPFLIEVSCLDNENVSKFCLDSIRQLSYKLLE
RKELENFQYQSEFLRPFEHILIHSKFRSVKQLGVFCVNQLLNSHGSNIHSGWQTVLNILS
FAAKEFDADCKETILDCLTIIVENYSEQTFKWMDSVLSLLTMISLSLEPDNINLRSTKLL
LVYYDKTYNSKNFENDINDISDDFYCQKWNKGLKRIIESFVTIIKEGSPSIRADALVFLF
NIFKLYPESIHPDKWVEIFEIFHDLLIFVFDESANFSSDFGIERVHHLSSAIIGGISEIY
IKFFDQLPRSLSRSYFECLKIVAVIDNDIYKNNIHFVIKLLLENLYERLDDDHWKQVAEF
IQYLFTKYTPDEFLDSSLIASRVTEAKSKHQGDDNIKLHFDYGSIDQDAHFIISGKQNSP
NEYRTKILSQLSMCKFDIELLKTIESMISLSKLEPGSKVSSQIFLKMSQECFDAFFEIIN
NHRTVLMTLNTNEKHLTNIYSFIQDYIPEFKMVWNGVHPPSMAIQETMATICLLKFLCLH
CFKNNFSDVCFEPFTQHIKSILERFPGLQNQCIDADLTHCLIENTLRLLTYTPDQFFESS
IKILYSSIYPLIKIDMDARASDLLMQILQRLEKLIQLI
Download sequence
Identical sequences A0A0C2J2M2
KII63327

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]