SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for KII75056 from Thelohanellus kitauei

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  KII75056
Domain Number 1 Region: 1-101
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.41e-17
Family Regulator of G-protein signaling, RGS 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) KII75056
Sequence length 108
Comment pep supercontig:ASM82789v1:scaffold01172:5527:5853:1 gene:RF11_03128 transcript:KII75056 gene_biotype:protein_coding transcript_biotype:protein_coding description:Regulator of G-protein signaling 4
Sequence
MKDHYCDENLQFWKVVEEYRLTLIPFKRRTISKNIYEHFIKQGAENEVYELNYKINISHN
HSLALKQAIEENGTDNIDIFDETQRDIFILMSLDTYPKFLEFIRINFL
Download sequence
Identical sequences A0A0C2N5Z0
KII75056

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]