SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427722051|ref|YP_007069328.1| from Leptolyngbya sp. PCC 7376

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427722051|ref|YP_007069328.1|
Domain Number 1 Region: 98-222
Classification Level Classification E-value
Superfamily Cysteine proteinases 9.32e-37
Family NlpC/P60 0.0000144
Further Details:      
 
Domain Number 2 Region: 9-81
Classification Level Classification E-value
Superfamily Prokaryotic SH3-related domain 3.48e-19
Family Spr N-terminal domain-like 0.00074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427722051|ref|YP_007069328.1|
Sequence length 235
Comment NLP/P60 protein [Leptolyngbya sp. PCC 7376]
Sequence
MPMSLPPSPSGEYFCLENLDLYDDPECTSLGSQAAQGRRIQMLNKENDHAVRVMTVEDGY
CTWLKKDRLSALEIAEDHYEFVPYSRNEIEEKLEAVIIFAQAAKRVNNTYLWGGTTAPNY
DCSGFVQSAFASEGIWLPRNSYQQGDFTESISLEDLLPGDLIFFAKEQRIDHVALYLGEG
YYIHSSGRDMGRNGIEIDRLWEPWDTISRAYHQTLLGFGRVNESYAPPSLICQLI
Download sequence
Identical sequences K9PUN2
gi|427722051|ref|YP_007069328.1| WP_015132282.1.56710

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]