SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427722057|ref|YP_007069334.1| from Leptolyngbya sp. PCC 7376

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427722057|ref|YP_007069334.1|
Domain Number 1 Region: 15-211,311-401
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.46e-90
Family Bacterial dinuclear zinc exopeptidases 0.0000197
Further Details:      
 
Domain Number 2 Region: 195-312
Classification Level Classification E-value
Superfamily Bacterial exopeptidase dimerisation domain 1.79e-32
Family Bacterial exopeptidase dimerisation domain 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427722057|ref|YP_007069334.1|
Sequence length 402
Comment amidohydrolase [Leptolyngbya sp. PCC 7376]
Sequence
MVATVSLDAILHKHRIRPAIQALQTELVEWRRTFHKKPELAFRENLTAEFIAQKLTELGI
DHQTGIAKTGIVAVIKGKDEGKVLGIRADMDALPIQEENEVDYCSQHDGVMHACGHDGHV
AIALGTAKYLSENRDSFNGTVKIIFQPAEESPGGAKPMIEEGVLKNPDVDAIIGLHIWNN
LPLGTVGVRPGALMAAAETFHVRVQGKGGHGALPHQTKDAIVIGSQIVTAFQTVVARSVN
PIDSAVVTVGEFHAGDAHNVIADFAELSGTVRYFNPELRDLRDRLEAIINGVCHSYGATY
ELDYIRMYPPTINDPAIAALVKTVAEESIETPLGVAPECQTMGSEDMSYFLQEVPGCYFF
LGSANPQLDLAYPHHHPRFNFDESALGMGVEMFVRCVEKFLA
Download sequence
Identical sequences K9PSW5
WP_015132288.1.56710 gi|427722057|ref|YP_007069334.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]