SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427722071|ref|YP_007069348.1| from Leptolyngbya sp. PCC 7376

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427722071|ref|YP_007069348.1|
Domain Number 1 Region: 5-334
Classification Level Classification E-value
Superfamily Pectin lyase-like 4.08e-31
Family Filamentous hemagglutinin FhaB, secretion domain 0.0089
Further Details:      
 
Domain Number 2 Region: 468-598
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000016
Family Filamentous hemagglutinin FhaB, secretion domain 0.051
Further Details:      
 
Domain Number 3 Region: 337-466
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000000942
Family Filamentous hemagglutinin FhaB, secretion domain 0.077
Further Details:      
 
Weak hits

Sequence:  gi|427722071|ref|YP_007069348.1|
Domain Number - Region: 597-715
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000439
Family Filamentous hemagglutinin FhaB, secretion domain 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427722071|ref|YP_007069348.1|
Sequence length 979
Comment filamentous hemagglutinin family outer membrane protein [Leptolyngbya sp. PCC 7376]
Sequence
MVVLETQATAQIVAADGTVGTVVSGISSLDITGGTQQSTALFHSFSEFSPGFADVTFNLN
MSQNLVDIVIGRVTGNNPSFIDSNLILTGGNNPDLYLLNPNGITFGPSASLSLPGSFIAT
TADSLVFRNNLEFSAATANPAPLLTISTPMGLQLGTNPGEIFIDDGVLEIGSGQTIGFVG
GTVTLDAGVLEASEGRVELFAAANAFVPLTMANNQQALGTQPTVGEWRDITLQNDSDIFN
RGNGGGAVQIQGRNITLKEQSSIRVINDGAIAADDISIYGSEQVLLTDENTSGSESLIFS
EVDDDATAGGEGADINIFTERLLVRDGASIFSQTESVGTGGSINIDADYVEVSGQGVADG
FSSIRSEVDDEVGATGRGGDVIINTQTFLADGAVLGAESEGPGDAGDFRLTATGDVILRG
VQADGLGTILTLETEESGAGGNLFLQADRLFLMDGALIDVDTENTGQGGNIQIGASLVSL
SGINDRGFGSAITTEVDPDALAIAQGGDIFIDAERLELRDGSVINSSARAAGTAGNVLIN
AQTVELDGAIESLRGTASIKSGVIGNVAGTGGGITLNTNTLTLQNGAIIDAATEGSGNGG
SIDVQAQTINISGQTLMGNRGGFTTAVRTGATGQAGQIRVQTNDLTLQGGDITASTAGGN
NAGQIEITATGLVKVSETGTIQSQALPGSIGNGGDINLSAGELTLTDAKITANNLSSGGS
AGDVAIAVPTRVTLERGQITALANDGDGSDLTVNAGEALLLRDNSLLSTATRNGNAGDIN
LTAPLIVGLPLENTDIVAQSLTGNDGRISITTQGLFGLRFRPQQTPKSDIVPGAELGGSL
GFGVSGIVEINSSKGEQNIFWIALLNRLKAPDKEISYTCDNSKGNTFTITGRGGLPPSPV
GTLIQNRHFWIDMRTVSFENNGDAKIPSLSSDQPVTQPLTATNGWHRTNASDIELISTAA
KPPILTSNATCSGFASISR
Download sequence
Identical sequences K9PUP7
gi|427722071|ref|YP_007069348.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]