SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427722115|ref|YP_007069392.1| from Leptolyngbya sp. PCC 7376

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427722115|ref|YP_007069392.1|
Domain Number 1 Region: 341-708
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000000000000404
Family Galacturonase 0.066
Further Details:      
 
Domain Number 2 Region: 593-922
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000000162
Family Galacturonase 0.015
Further Details:      
 
Weak hits

Sequence:  gi|427722115|ref|YP_007069392.1|
Domain Number - Region: 869-1068
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000514
Family Galacturonase 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|427722115|ref|YP_007069392.1|
Sequence length 1227
Comment hypothetical protein Lepto7376_0108 [Leptolyngbya sp. PCC 7376]
Sequence
MTSSILIRVYAFPLLLASQIVAAQTVNAVEVFTTTDNEAKLSEESKVQEPKEMQIAQVED
VTETTVVKSNLGASFTTGEGVGYSSSFGSINGFVPLSQEPGSRLWYLYGRANLDTEDSEF
SSNTVLGYREYSPALDIVFGGYVGLDIRNTTNDNTFNQIGLGFEVLGEPWEIRANGYIPV
GDRRDILREGTATITDRTFVGNTLLYSAAQTNLYEESLMGLDIEGGLRLANWNGGNLKGY
LGLYLYDGLSGSGFVGLSSRLLAEISNNFNAGVSLKTDSEFGTTLSFTVGASFGGNASAR
KDQTPEESVIARLGDRLLRQSNVSIREEFSTVAIANNATAINPKTSKPWHFIHVSPNGNS
DGSVEDPFGTIDEALASNPPDNAIIYVADFAEAQGSFTLPDTIQVLSTGPEQFIPITELG
SIQLPNSGSGLFPAITGTGNLGNSNTIAGFSFEPMADEAAIIGSGITDTTIRNNVLAFSG
SIGESLITISEGVGTINILDNRFSGDSDSLLRISSQTEVPSSQNSDITISGNTFNSLSEG
SGDNGVTVATNSKSDIITISDNTFLNLDTGITVANFQDTGKVTISDNIITGNSSSQAITF
LNSGATSAVLQEPDLITNRALNLMISGNTISGFEQSIAGSFNANGRLISSDIIIRDNTIS
ETIIGINIIELSANEGKLTSNLTLSNNNISGTQIAETENGILVSGSSSYGGDLSRNVTIS
GNTISSVLNGIRVGDVTVVSNDPTDLELAQKPAALNSSITISENNITNSGSGVQIASGAS
GEKATASQTISIEGNNLDIATSTISGNISLSPSVLYISTNAAEGGTINSTIDLENNQISL
ESTSDRSGILIDNIATSKTDNQTSIDSKIAISGNTVSGGDASVQVIERSGVSNPSSSQAL
YGYLDSDVEISKNILTSERDESNLISFDIQSASNAESESKIVISENNLTNTGSGIDIAIN
VSDEADASGNITISDNNINNRDTGINITREVNNDGNISDEITVSRNTLISNNGEGIALSV
SAYSYGTTTTNATISSNTVMSQEAGINFDIESNADAEISNTANILDNTITVTSNSDDGIV
ISNDIGASPDDSAFSVLETIISGNTINPGGEDGIEISNTGAEDADGDQIDGIAEANIIIT
SNNISGVSDNGIKIYQESGQKICVSLKDNTVTDIGENGFNLSNIYGDFFIVDKAGLLMNN
IGDFDPADIIVNADFRTVSSCPELSSP
Download sequence
Identical sequences K9PTW3
gi|427722115|ref|YP_007069392.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]