SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427722184|ref|YP_007069461.1| from Leptolyngbya sp. PCC 7376

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427722184|ref|YP_007069461.1|
Domain Number 1 Region: 1-320,433-474
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.23e-59
Family FAD-linked reductases, N-terminal domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427722184|ref|YP_007069461.1|
Sequence length 487
Comment zeta-carotene desaturase [Leptolyngbya sp. PCC 7376]
Sequence
MRVAIVGAGLAGLSTAIELVDAGHEVEIFEARPFVGGKVGSWVDKDGNHIEMGLHVFFGC
YYNLFALMEKVGAGNNLRLKEHTHQFINEGGKLGELDFRFPVGAPFHGLKAFFTSSQLSL
IDKAANSLALGTSPIVRGLVDFKGAMKTIRDLDRISFADWFRSHGGNDGSLKKMWNPIAY
ALGFIDTENISARCMLTIFMFFAAKTEASVLRMLEGSPAEYLHKPIVNYLESKGAKIHTR
HRMKDIHYTLDGTPTIDGLVINNGETDETVKADTYVLALDIPGIQRAVPDAWRKWPEFDN
IYKLDAVPVATVQLRFDGWVTELNDPEKRAQLEKAEGIDNLLYTHQADFSCFADLALTSP
GDFYKEGEGSLMQLVLTPGDPFIKKSNDEIAQHVLEQVHKLFPSSRELNMTWSNVVKLAQ
SLYREAPGMDPYRPAQDTPISNLFLAGSYTQQDYIDSMEGATISGRQAAEAILAKAGELE
KPLVATM
Download sequence
Identical sequences K9PVS2
WP_015132414.1.56710 gi|427722184|ref|YP_007069461.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]