SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427722205|ref|YP_007069482.1| from Leptolyngbya sp. PCC 7376

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427722205|ref|YP_007069482.1|
Domain Number 1 Region: 14-80
Classification Level Classification E-value
Superfamily Homeodomain-like 7.98e-16
Family Tetracyclin repressor-like, N-terminal domain 0.0077
Further Details:      
 
Weak hits

Sequence:  gi|427722205|ref|YP_007069482.1|
Domain Number - Region: 96-204
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 0.00356
Family Tetracyclin repressor-like, C-terminal domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|427722205|ref|YP_007069482.1|
Sequence length 206
Comment regulatory protein TetR [Leptolyngbya sp. PCC 7376]
Sequence
MGQVTPIENERNLSSEKTEAILQGGMREFLANGYAATSMDRVAKSSKVSKATVYSHFQDK
ESLFVALIQHLVEKKFRSVFDPVNAGKLSSEPEIILKQLAYRMLDAGSEKPLFQNFMRVI
IGESGRFPHLARAFVTNVEKTGFRLLTEYFTTAPHFDFEDPEAIARIFVGSLAHFIIVQE
MLHGKEIIPMERERLVGSLVDLILKK
Download sequence
Identical sequences K9PU53
WP_015132434.1.56710 gi|427722205|ref|YP_007069482.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]