SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427722248|ref|YP_007069525.1| from Leptolyngbya sp. PCC 7376

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427722248|ref|YP_007069525.1|
Domain Number 1 Region: 4-560
Classification Level Classification E-value
Superfamily Acetyl-CoA synthetase-like 1.23e-111
Family Acetyl-CoA synthetase-like 0.00053
Further Details:      
 
Domain Number 2 Region: 691-1047,1078-1097
Classification Level Classification E-value
Superfamily Thiolase-like 2.89e-100
Family Thiolase-related 0.0031
Further Details:      
 
Domain Number 3 Region: 1195-1319,1377-1491
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 4.71e-78
Family FabD-like 0.00018
Further Details:      
 
Domain Number 4 Region: 2426-2706
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 4.02e-48
Family Haloperoxidase 0.071
Further Details:      
 
Domain Number 5 Region: 1769-2000
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 8.3e-46
Family Tyrosine-dependent oxidoreductases 0.0000607
Further Details:      
 
Domain Number 6 Region: 2136-2184,2226-2360
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.56e-33
Family PAPS sulfotransferase 0.055
Further Details:      
 
Domain Number 7 Region: 1555-1757
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 1.97e-30
Family Tyrosine-dependent oxidoreductases 0.002
Further Details:      
 
Domain Number 8 Region: 600-707
Classification Level Classification E-value
Superfamily ACP-like 3.4e-16
Family Peptidyl carrier domain 0.061
Further Details:      
 
Domain Number 9 Region: 2023-2107
Classification Level Classification E-value
Superfamily ACP-like 0.000000000000393
Family Acyl-carrier protein (ACP) 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427722248|ref|YP_007069525.1|
Sequence length 2708
Comment Long-chain-fatty-acid--CoA ligase, 6-deoxyerythronolide-B synthase [Leptolyngbya sp. PCC 7376]
Sequence
MFGQFTSFVDLLQYRAESQPDKTIFTFLADGEAETDSLTYGDLHTRARAIAAYLQTHHAR
GERALLLYPPGLEFISAFLGCLYAGVIAVPAYPPRPNRSFGRLYSIIQDAQAQFALTTAE
LRGKIANRFEELENSAFQCLSTDNLSLDLAAAWKNPNVGLDDLAFLQYTSGSTGNPKGVM
VAHSNLLHNSHIIQTGFKNSQDVRAVSWLPPYHDMGLIGGILQPIYVGIFQVLMPPVSFL
QRPFRWLKAISKYKATTSGAPNFAYDLCVSQITQEQKSTLELESWQLAFSGAEPIRSATL
DNFSQHFAEVGFDKKAFYPCYGMAETTLMVSGTEPQALPREITVSKQAIEENQVREAIAD
EPTVTLVGSGQIIGDLAVRIVNPETLARCTDSIIGEVWVNGESVAKGYWQKNELTERTFQ
AQVDGETGFLRTGDLGFQRDGELYITGRLKDLLIIRGRNHYPQDIELTVEKAHPAIRQGA
GAAISVEVDGDEQLVIVQEVERKFVRHLNVEEVSQAIRGAIATEHQLQPYAICFIKTGSI
PKTSSGKIRRHACKLGFLDESLSVVGQWVQGLETRQSQPVTSEQKAPSHTWAAVGKGDRQ
QQELEAWLIDNIAQRLGVNSNKINVLEPFASYGLDSVQAVQVTADLEDRLERKLEPTLAY
DYPSIRALAAFLITGETATQTFAITPEKKLQNSEIAVIGLSCRFPQANNPEAFWKLLAQG
KDGIRQLGDRWGSDEWGGFLDEIDQFEPSFFGISPREAEQMDPQQRLLLEVSWEALERAG
IPANKLANSPTGVFVGISNSDYAQLQVREKNPINAYMGTGNAHSVAANRLSYFLDLRGPS
LSVDTACSSSLVAVHLACQSLINGECKQAIAAGVNLILTPDVTQTFSQAGMMSGAGRCKT
FDESADGYVRGEGCGAVILKPLADAERDGDSVLAVIHGSAINQDGRSNGLTAPNGLAQQA
VIQQAIARAGMSAADLDYVEAHGTGTPLGDPIEINSLKSVLKNDGQMREKPCVVGSVKTN
IGHLEAAAGIAGLIKIVLSLQHGKIPRHLHFQQLNSRIDLEQTLTIPAVAQLWIKLNQPR
FAGVSSFGFGGTNAHIIVGDRPTTTPQQSQAKKRPWHVLTLSAKNQVALKAVQGNYAKYL
TTQSDLDLQKLCLTANTGRSHFNQRRAIIFQDQADLQSQLATSVSSPPAITPQKIAFLFT
GQGSQYVGMGQQLYETQPLFKSVLDECDRLWQSFSSDAPTLIDLLYGGHDPQIVNQTIYT
QPLLFAVEYAIAQLWLSWGIAPDFCMGHSVGEYVAACLAGVFSLEDGMKLITARGKLMQN
LPSNGGMAAVFADKTAITPYLSKNLTVGAENGSHLVLSGQTLCLEQSLSKLQRQGIKTKA
LKVSHAFHSPLMAPMLGAFRQVAEQIQFHEPRLPLISNVTGQEIGSAIATADYWVSHVSE
PVKFVQSMQTIAAAGVNVFLEIGAKPVLLSMGRHCLPDVEALWLPSLRPQNDDWQEMFTS
LGKLYEQGLNINWQAVEADYTQQKLTDLPTYPFQRKRYWFSEKSWTNSETIEADFSEWFY
EVQWHQVELPQASEQKEGLWLILGDHHSQTLEIAQQFPQSQIVSLGDEFQQHSDHWEVHP
DQFDQLFTSLANTKLAGIIHGWAIAAEEQNLDHSQWLTCYTTLQLIQSLQRQQRQIPCWL
LTRNSQAVLENDKVEGFTQNSLWGMGKTIALEHPELWGGIIDLDAAIPNLTKLCNQTKIQ
HLACRNGSIYCSQLVPQTVTKTKISAIVPQAVYLITGGLGSIGRRLAQWLDEQGATKVLL
LTRRSLATDDSRLADLPKSAIAYTCDIADDHEVQNLFQRYPNISGIFHAAGVLEDGFLAT
QTWKNFEKVFAAKVQGTWNLHHHSLTNPLDFFVTFSSVASIVGSPGQGNYAAANGFMDAI
ARYRQGQGLPALNINWGPWATDGMATALRNQGMAFLAPEQGLHILETVLAQQTNVGVFKP
DWQQLSRQFPAIANSYYFRAVMGETEEVSTQNDIFERLQTLPTTEQQQQLTDYLRESIAR
ILKLDSTQIQPSDNLLDLGMDSLMVMEAIAHLKQDLRLMLYPREIYERPKLEVLAKYLGD
EFQKAHNPDYQQKTVSIPTQLPSQTNKTWQIPAQKNEKPIAFILSSPRSGSTLLRVMLAG
HPELYSPPELHLLPFETMGDRQEELGLSHLGEGLQRAIMDLDGLTAEESQQTINQWLTEN
RSIGDIYSELQTKATGRLLIDKSPSYGSDRQTLEHSEILFENAKYIHLVRHPYAMIESFS
RLRMDKLLGDTSANPFGLAESIWTKSNQNILHLGQTLSPDKYLQVVYEDLVKNPRVVLTQ
ICKFLGVDFDESLLNPYSGDRLTDGLHQQSMGVGDPNFLKHKNIDPALADKWRNVQLPQP
LNPTTIRLAQTFNYDLPNEDLTVSEVPTMTERSVTVRGLNYCLCEWGDRTKPLILMLHGI
LEQGASWQLIAPQLAAQGYWVVAPDLRGHGKSDHAQSYSMLDFLADVDTLAKELTDQSFT
LVGHSMGSIIGAMYAGIRRDQVKHLCLVETIVPNDIDDAETANHLVTHLDYLATPQEHPT
FPDVAIAARRLRQVTPALSEELSLKLVERSTEQTETGYQWRWDAFLRTRAGIEFNGISRR
RYLALLENIQAKITLIYGDQSEFNRSEDLAATQAAMPNAQRLTVNGGHNLHFENPEAIAR
ILMECLTF
Download sequence
Identical sequences K9PUU3
gi|427722248|ref|YP_007069525.1| WP_015132477.1.56710

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]