SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427722330|ref|YP_007069607.1| from Leptolyngbya sp. PCC 7376

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427722330|ref|YP_007069607.1|
Domain Number 1 Region: 51-214
Classification Level Classification E-value
Superfamily PRTase-like 2.56e-22
Family Phosphoribosyltransferases (PRTases) 0.0079
Further Details:      
 
Weak hits

Sequence:  gi|427722330|ref|YP_007069607.1|
Domain Number - Region: 9-37
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00889
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|427722330|ref|YP_007069607.1|
Sequence length 229
Comment hypothetical protein Lepto7376_0332 [Leptolyngbya sp. PCC 7376]
Sequence
MLDWFLSIFLEAQCPLCQRVAKGDLVCRDCDRQLHQCKLPNPKLYWQDSLPLFVWGKYDD
ILKRAIATMKYQNQPLLGAWLGEQLAQTWQRSFADSQKLTVIPIPMHPQKYKERGFNQAA
LIAKRFAQLNRFRYVSHALKRTKATKALFNLNLSERQQEIRQAFSINPKTLPQLKRQRVL
LLDDIYTSGTTAQEVARTLTQKGISVMGIAAIATPKKQHPVKPIPKTSR
Download sequence
Identical sequences K9PUH9
WP_015132559.1.56710 gi|427722330|ref|YP_007069607.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]