SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427722403|ref|YP_007069680.1| from Leptolyngbya sp. PCC 7376

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427722403|ref|YP_007069680.1|
Domain Number 1 Region: 3-180
Classification Level Classification E-value
Superfamily Restriction endonuclease-like 4.08e-20
Family Hypothetical protein TT1808 (TTHA1514) 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427722403|ref|YP_007069680.1|
Sequence length 189
Comment hypothetical protein Lepto7376_0411 [Leptolyngbya sp. PCC 7376]
Sequence
MVVSTELKITPTEYLEREKTATERTEFIDGQLFPMAGASANHNQLTSKLTGFLTVGLDDE
IFDVFVSDMRVWLQETESYVYPDLVVSKCPSVFIDDSQMELTNPCFIAEVLSPSTARYDK
KAKFDLYKTIPTLEEYLILPQNQQKIELYRRLQQNQWLLTEFEIDDSPIMLESLNLEISL
PKLYKKVIF
Download sequence
Identical sequences K9PVE6
WP_015132630.1.56710 gi|427722403|ref|YP_007069680.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]