SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427722711|ref|YP_007069988.1| from Leptolyngbya sp. PCC 7376

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427722711|ref|YP_007069988.1|
Domain Number 1 Region: 1-576
Classification Level Classification E-value
Superfamily Prokaryotic type I DNA topoisomerase 8.5e-189
Family Prokaryotic type I DNA topoisomerase 0.00000000146
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427722711|ref|YP_007069988.1|
Sequence length 896
Comment DNA topoisomerase I [Leptolyngbya sp. PCC 7376]
Sequence
MSTLVIVESPTKARTIRNYLPQEYHVTASMGHIRDLPSSADEVPKDKKGQPWSQLGVNVD
ENFAPLYIVPKKKKKVVTELKQALKEADELILATDEDREGESISWHLLEVLKPKVPIKRM
VFHEITQEAIQKALTNCREIDVNLVHAQETRRILDRLVGYTLSPLLWRKIAKGLSAGRVQ
SVSVRLLVQRERERQAFQSGQYWDLKAQLQQKRSKFDAKLVTLDGKKIAIGSDFDPDTGK
LKKGKKVVLLSQEEAIALKERIKDQEWVVSKTEEKPSTRRPSPPFTTSTLQQESNRKLGI
SARDTMRTAQKLYEEGYITYMRTDSVHLSDQAVTAARSCVEEKYGKDYLSPQVRRYKTKS
KGAQEAHEAIRPAGSSFRTPKETGLSGREFKLYELIWKRTVACQMADAKLTQLSLTLKVD
DAEFRSSGKRIDFPGFFRAYVEGSDDPDAALENQEVVLPDLKEGDKPTCKQLDEIEHNTK
PPARYTEASLVKGLEGKGIGRPSTYATIIGTIVDRGYVQIRDKALTPTFTAFAVTALLEE
HFPNLVDTDFTSHMEHTLDEIATGKAQWLPYLKNFYLGDEGLGTQVKVQEENIDPSVAKA
IAIENLPVKVKIGRFGPYIESEQGEEKITASLPADLTPSDLDPAQVETILKQKTEGPEQL
GEHPETGDPIYLLVGSYGPYVQLGQVTEEKKKPKRASLPKNVKPEDLTFEMAIQLLSLPR
LLGEHPESSKPVKVGLGRFGPYVVHDQGKEGKDYRSLKKEDDLFTISFERAMELLAQPKR
SRGRGKTKTPLKELGKHPADNEPVNVYEGPYGIYVNHLKTNAGLPEGETVETITLAKALE
LIDEKAASKGKKKTTKKKTTTKKKTTAKKKTTTAKKKTTTAKKKTTTKKKAAASDE
Download sequence
Identical sequences K9PWF7
gi|427722711|ref|YP_007069988.1| WP_015132934.1.56710

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]