SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427722788|ref|YP_007070065.1| from Leptolyngbya sp. PCC 7376

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427722788|ref|YP_007070065.1|
Domain Number 1 Region: 4-224,317-359
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.17e-33
Family FAD-linked reductases, N-terminal domain 0.017
Further Details:      
 
Domain Number 2 Region: 226-313
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 0.000000000000249
Family D-aminoacid oxidase-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|427722788|ref|YP_007070065.1|
Sequence length 365
Comment FAD dependent oxidoreductase [Leptolyngbya sp. PCC 7376]
Sequence
MTQKVVILGAGIVGAAIAYELSLRPEFKVAILDTQQPTQGSTGAALGVLMGIISRKTKGR
AWQLRRRSMERFPVLLDELAVAGAPVPHNSHGILKLFDETTDLTKLERLQQKRHDAGWQL
ELWDQAKTETQCPQISSNICAGAVYSPQDFQVQPIPLARSLLEVATKNGLYSHFDIAPPT
LEFAQQKCVAVNSGDRRWTCDWLIIAAGLGSLEITKPLLDDFQMKSVLGQAFHVKLPDGK
QPDFAPVVSYNDIHVVPLGNNEFWVGATVEFPDEKGHLEADKALMEKVWQGAIAFYPALK
HAEILRHWSGKRPRPEGQGAPVLQPLKNYQNILLATGHYRNGVLLAPATALKIRDWLLAP
ETIPF
Download sequence
Identical sequences K9PWE5
WP_015133011.1.56710 gi|427722788|ref|YP_007070065.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]