SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427722831|ref|YP_007070108.1| from Leptolyngbya sp. PCC 7376

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427722831|ref|YP_007070108.1|
Domain Number 1 Region: 467-652
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.39e-40
Family Pentraxin (pentaxin) 0.0015
Further Details:      
 
Domain Number 2 Region: 174-394
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.15e-39
Family Clostridium neurotoxins, the second last domain 0.08
Further Details:      
 
Domain Number 3 Region: 11-189
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.8e-31
Family Trypanosoma sialidase, C-terminal domain 0.09
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|427722831|ref|YP_007070108.1|
Sequence length 730
Comment putative outer membrane adhesin like protein [Leptolyngbya sp. PCC 7376]
Sequence
MATASSKLSLLKFNGQNLFIDCGHHIDLNSTSFTIEFWAKRIGKQKFHVALQQGNTGHHQ
CLHIGFRQNNVFTLGFYFDDLDTSQTYTDSVWHHWSCVYDRDRQHQEIFCDGKSVASRTC
KNLQTNANFYIGCHLGNQLFFNGFLAEIRIWNRIRTASEIKQNMNTQLSGQETNLVSYWP
LDEGSGKTAHDKTGNGNKGTIHNANWQQVNVPFKPYIPSVKQEDSSMAKISSLMFNGIND
YVSIPDNASLQVSTYTTEAWFKTAGAVKGWFGVAGKPGRSHNIWLTDKRVFHIFHTTKDT
NRHVDPPHNLFQYGQWTHVAITNDGKTAKTYINGQLKVECPTGAALVVDKTPLYIGGDLD
GEDSKNFFAGQIAEVRLWNYARSPQEITQNMTKCLAGNETGLVGYWPLEEGGGSIAYDKT
GNGNNGTIHSGSWKTVEAPFQKYISPAKQEDSSMAQTRSALKFVNAKSPSDYFLVKPFSP
SPTHALTVEFWLKVASNGRNAGVPFALSSPSRANELVVFNCKNIELYIHDSQHQAGSASF
TKGQWQHCAVTWESATGQMHLYIDGQSVFDPVLAKGLVLDQTSAVILGQDPDSYGGSFDV
NQAFQGEMTELRIWDHVRTPEEIQARMNKCCTGKEAGLAGYWPLDEGEGAIAKDKTSNGN
NAELHGVTWVTTDELKLTKSRLNSKHIPVAQPRTNSVGLEDYAYWWKEVAKEQAGKKEQP
KKFRRGRIWS
Download sequence
Identical sequences K9PWT0
WP_015133053.1.56710 gi|427722831|ref|YP_007070108.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]