SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427723016|ref|YP_007070293.1| from Leptolyngbya sp. PCC 7376

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427723016|ref|YP_007070293.1|
Domain Number 1 Region: 176-490
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 3.14e-112
Family Leucine aminopeptidase, C-terminal domain 0.0000003
Further Details:      
 
Domain Number 2 Region: 1-179
Classification Level Classification E-value
Superfamily Macro domain-like 1.12e-31
Family Leucine aminopeptidase (Aminopeptidase A), N-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427723016|ref|YP_007070293.1|
Sequence length 491
Comment leucyl aminopeptidase [Leptolyngbya sp. PCC 7376]
Sequence
MQIKGITQAAADWSGDAIALGFFSSEEVISLPESLGALDSKLSGAIAEILAETEFKGKSG
STSLNRVGGGAEIKKVLLVGLGDEDKWDGKAVRSTGAAIARAVKGDQNIKTLAISVPPLD
DAAATAQMITEGITLGLYADNRYKSGDDIKEPALETVDILGIGDQSEAIATGSILCEGTI
YARELVNSPANVINPVTLAASVKELADEYGLELTVLGQDECEAQNMGSYLGVAEATDLPP
QFIHLIYKPEGTPRKKLAIIGKGLTFDSGGYNIKPSGPSIAMMKMDMGGAAATFGAAKAI
AQLKPDVEVHFISAATENMISGSGLRPGDILTASNGKTIEVNNTDAEGRLTLADALVYAE
KLEVDAIVDIATLTGACVIALGEEICGLWGDDELADAISSASEKAGEEFWKMPMPPKYFE
GMKSPIADMKNTGPRYGGSITAALFLKEFVEDTPWVHLDIAGPAWSDKESDIYSKGGTGF
PVRTLVHWVLS
Download sequence
Identical sequences K9PXE3
gi|427723016|ref|YP_007070293.1| WP_015133232.1.56710

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]