SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427723023|ref|YP_007070300.1| from Leptolyngbya sp. PCC 7376

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427723023|ref|YP_007070300.1|
Domain Number 1 Region: 5-67
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 0.00000000000000466
Family 7-Fe ferredoxin 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427723023|ref|YP_007070300.1|
Sequence length 74
Comment ferredoxin-like protein [Leptolyngbya sp. PCC 7376]
Sequence
MPHSIVTDVCEGVSDCVEACPVACIHDGPGKNAKGTDWYWIDFDVCIDCGICLQVCPVKG
AIIPEENSEKQRTP
Download sequence
Identical sequences K9PX36
gi|427723023|ref|YP_007070300.1| WP_015133239.1.56710

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]