SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427723098|ref|YP_007070375.1| from Leptolyngbya sp. PCC 7376

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427723098|ref|YP_007070375.1|
Domain Number 1 Region: 50-277,340-369
Classification Level Classification E-value
Superfamily Pectin lyase-like 3.14e-31
Family Filamentous hemagglutinin FhaB, secretion domain 0.01
Further Details:      
 
Domain Number 2 Region: 511-806
Classification Level Classification E-value
Superfamily Pectin lyase-like 1.72e-28
Family Pectin lyase 0.085
Further Details:      
 
Domain Number 3 Region: 1004-1080
Classification Level Classification E-value
Superfamily Invasin/intimin cell-adhesion fragments 0.0000031
Family Invasin/intimin cell-adhesion fragments 0.0085
Further Details:      
 
Weak hits

Sequence:  gi|427723098|ref|YP_007070375.1|
Domain Number - Region: 741-912
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000675
Family Virulence factor P.69 pertactin 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427723098|ref|YP_007070375.1|
Sequence length 1564
Comment filamentous hemagglutinin family outer membrane protein [Leptolyngbya sp. PCC 7376]
Sequence
MFRLRLSALLVLFPVATLHTLPAIAQITPAGDGTGTLIDQTGDAFAITGGSTAGNNSNLF
HNFSDFNLATGQSANFFANPDIQNILSRVSGGNPSFIDGLISVTNSNANLFLLNPSGLVF
GSNAQLNVAGDFTASTAWGLGFDDEIWVDGADYAQLTGAPTQFFFDGTGAIINAGDLNVV
PGQAINLFASNVVNTGNLTAEEGTIQAIAVPGSNTLRLSQAGQILNLEIIPTSGNLTTTN
LPELLTGSGLDSSVTSVNISAESGRTFITGNLDTSGAVGGNIGVFGENIFLESANLNTSG
TNGGGEMFVGGDYQGLGTLPTALNTFVDANSTLDSRAITAGDAGQIIVWADNATGFYGEA
IATGGLLSGDGGLIETSGKNYLDVFGSSVDASAINGLAGQWLLDPTDINIVSTGTGVLSG
GVFNPPTTAPPASDIDPATIVTALDGGTDVIITTSAGTGGSGDITLSESIIQGGGGTASL
TFIGRRFILPGAAIIDMNSSGGLTFNINSIGSGTATATELGTALQDAHDSIGAVTGTRTI
NLAAGTFTTAAGFGINREVTINGAGESFTFLDDGDPTLATGSNHIIVSGGTGDITIQNLT
IRYGGTFATANGGGIYNTADTLNLNNVTISDNFSPGAGGGIYNDDGDVTITDSLFSGNSA
TGIFAGDGGGAIANDGTGNVTILRSTITGNSATSTGILGGVGGGILNDGDTLEIRNSTLS
SNTATYGGGGIDNLGTFILANSVITGNTVTDITGYGGGLKLSLGGTATITDSLITSNTNA
GYGGGIANFSATADLTRTTISGNTAVDDGGGIFNSTTLTLTDSTVADNTSTGGRGGGLYN
EDLGGDLALINTTVSGNTATLGGGIYNDYDLALTNSIIANSTSGDIREGANSTISTSGVN
LVEDGSITGASIITLDPSLTPLGDYGGIDVGDPNTGTSNLETHFFFFDSPALNRGDDSFV
SSTTDQRGGTRIIDTAVDLGAVEFQGVSLALVSGDGQSTDINTDFDPVTVSATEVTFGNI
LENLEVEFDAPGSGASSDPTNLSGTTNASGVVSVTPTANDTVGSFEIQATTPTFSVSNTV
LADLENTDPDDPDDPDDPDDGDFDDSCTGVTNCEDPVSDPEPEDGLADERGSNIAQITSK
LEKVQEQTGVNPALIYAFFSPPEQDDLVATKDNRVATKVEDSKDGSEKDLTQWSYRGDRL
SDFLNAEEKFLNPPEKLDNDEELELVMVTYSGKIIRKKVPGVTRRNVMPEVRDFIRGVTN
PRFGNRYLKPAQYLHSIFLDPLEADIAKEQINNLTFIMDEGFRALPVAALHDGDKFLIEK
YSIGLMPSFSLTNTSGYIPPRQNQLLAMGAAEFGDGLDDLPAAPVEAQIIADQIWQGDVF
VDQQFTVENLLSAREQNPYGIVHLATHGEFRAGDNNNSFIQFKDQRVTIDRLSSLRLNEP
PIELLVLSACRTALGDRQAELGFAGLALTSGAKSAIGSIWYVSDEGTLALMARLYEELQK
SSIKAEALRQAQLSLLRQEVRTENNTLITPDGEITLPPELQQSQDLNLSHPYFWSGFTIV
GNPW
Download sequence
Identical sequences K9PXA8
gi|427723098|ref|YP_007070375.1| WP_015133314.1.56710

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]