SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427723205|ref|YP_007070482.1| from Leptolyngbya sp. PCC 7376

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427723205|ref|YP_007070482.1|
Domain Number 1 Region: 30-284
Classification Level Classification E-value
Superfamily Pectin lyase-like 2.2e-30
Family Filamentous hemagglutinin FhaB, secretion domain 0.026
Further Details:      
 
Domain Number 2 Region: 733-1005
Classification Level Classification E-value
Superfamily Pectin lyase-like 1.91e-25
Family Galacturonase 0.02
Further Details:      
 
Domain Number 3 Region: 508-755
Classification Level Classification E-value
Superfamily Pectin lyase-like 7.42e-21
Family Galacturonase 0.04
Further Details:      
 
Weak hits

Sequence:  gi|427723205|ref|YP_007070482.1|
Domain Number - Region: 1030-1103
Classification Level Classification E-value
Superfamily Invasin/intimin cell-adhesion fragments 0.00447
Family Invasin/intimin cell-adhesion fragments 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427723205|ref|YP_007070482.1|
Sequence length 1197
Comment filamentous hemagglutinin family outer membrane protein [Leptolyngbya sp. PCC 7376]
Sequence
MTIQDSKQPLVLFLLTGLVLGLPQQVLSQSITSAPDGTGTVINHNGDTYQINGGTRAGLN
LFHSFQDFGLEPSEVANFLSDDSIDNILGRVTGGDPSIVQGLLQVSGGNSNLFLTNPAGW
IFTDDAGVDVSGSFGVTTANRIGFSNGFFNSAGDNDYAALSGNPTSLIFDSTQPGAIFNG
ANLEIDNGSLWMVGGSVISTGSLTAPNGTITLAAVPGESQVQLSHDSMVLSLLLDAVPSD
TLPTDAANGIRPVDLPSYLNSTDSLGNASELEVDADGNLWLVGSQMRIEEGDVIIDDRLT
AQTINLLAAEQVLSTEPNLVTGDVTVVRYSGASDPLTFTAIDTTVEDYQTFLFGGDRGTI
SFTVNPDENGITKIGDRLSNLEGTGTQADAIQIISEGDVGNFWLGNTFISEDTIEQYEAE
FAGWQPHLTTTADLLIYACLTAFGEVGDRLLQYLADTTGTDVAASTDLTGSTALGGDWIL
EKSVGAIGTSPQFTTGTLANYLGKLAIFTVTDGADTGAGSLRQAISDANGAAGADEIRFS
NVPLVDLTSGELTITDELTLTGGNSNVTVQRNAGAGDFRIFNVTGGVTTTFDNLTITNGE
TTGNGGGINSNGEVNLTNTTVSGNTSSDRGGGLYNTTHAVNIIDSTISGNTSSDNGGGIY
NRSGNITVTDSVISGNSSNRYGGGIHTRGQIGVTNSTISGNFSRRNGGGLYSRSGNITVT
DSTVSDNQSNRHGGGVWARNRNITITNSTISGNSSRLSAAGTYSSTLIVTDSLVSGNTSG
DLGGGLYTTGSATITNSTISGNSSSNKGGGIYFRKNLDITNSTLSGNSSNRGGGIYSRGG
GTVNITNSTISGNSSTNRGGGIFARGSGGGTINIRNSTIAHNTADNNGGGIFRNGGGFDI
TNTIIANNTAANSGNDLSGTFTSIQDSLIGDPIGATITTDLNNLKNVDPQLLPLGDYGGD
TQTHAFYLGSPVHNAGNDALAAALVTDQRGANRFNGTVDIGAFESQGYSLTTVTGHGQVA
LVNKTFDTALSAQITENFVHTAIPVENVPIIFNANHGNTGASGSPGGSVLTDADGLATAA
NMFTANAIAGDFTVTASSPNLSSAIFNLTNLPIPESPNSPESPSEPNVPDVQNIWPDPVE
RTEEITDNFIGADCQTIPAVEVTDEAEKLDEQLDEEIKKDQDDALGKLEQDCSLSLR
Download sequence
Identical sequences K9PWZ6
WP_015133421.1.56710 gi|427723205|ref|YP_007070482.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]