SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427723206|ref|YP_007070483.1| from Leptolyngbya sp. PCC 7376

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427723206|ref|YP_007070483.1|
Domain Number 1 Region: 29-301
Classification Level Classification E-value
Superfamily Pectin lyase-like 5.96e-31
Family Filamentous hemagglutinin FhaB, secretion domain 0.026
Further Details:      
 
Domain Number 2 Region: 511-909
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000000000102
Family Pectate transeliminase 0.034
Further Details:      
 
Weak hits

Sequence:  gi|427723206|ref|YP_007070483.1|
Domain Number - Region: 945-1008
Classification Level Classification E-value
Superfamily Invasin/intimin cell-adhesion fragments 0.000659
Family Invasin/intimin cell-adhesion fragments 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|427723206|ref|YP_007070483.1|
Sequence length 1104
Comment filamentous hemagglutinin family outer membrane protein [Leptolyngbya sp. PCC 7376]
Sequence
MTIQDSKQPLLLLFITGLVLGLPQQVLSQSITSAPDGTGTIINYNGDTYQIDGGTRAGLN
LFHSFQDFGLEPSEVANFLSDDSIDNILGRVTGGDPSIVQGLLQVSGGNSNLFLTNPAGW
IFTDDAGVDVSGSFGVTTANRIGFSNGFFNSAGDNDYAALSGNPTSLIFDSTQPGAIFNG
ANLEIDNGSLWMVGGSVISTGSLTAPNGTITLAAVPGESQVQLSHDSMVLSLLLDAVPSD
TLPTDAANGIRPVDLPSYLNSTDSLGNASELEVDADGNLWLVGSQMRIEEGDVIIGDRLT
AEAVNLLAAEQVLPTESGLVTGDITVVRYPKVGNDLTYNFIDSLIEDPESFLYGGEQGSI
STIVTTDQNGIEVITEKLGAIATDNGELDGLRIVGEGNEADFWLGNAWVSEETIDNYSSQ
LASWSGALAEGADLLLYSCLTASDLRGENFVNTFADLTGMDVAASTNLTGSAALGGDWNL
EYQTGSIETGIGFETSVIENFTDTLVVFTATDATSLIAAINTANGNAVTDTINLANDITL
TAIDNATNGDNGLPSVTATERLTINGMGNTISRDAGAPGFRLLHVSLGGDLEVNETTLSG
GLANSGGFFGPGNNGGAVFNLGTLSVNDSIVSGNEADADGGGIYSFGSITGGALATITSS
TISGNTAGSTGGGISNSAFTGGPTNTPNAAVMTIENSTIINNSANTGGGISNFGQNADNS
AVMRVNNSTISGNTASFAGGGLYNRGQSSSQGATLIITNSTVVQNETTLIGGQSGGVHNT
GVFGGPNTGRLIVGNSVIAQNTATQTPDVGHDVPFVSSPVVDEGHNFIGIDEQGLFTVST
LIGSITTPLDPDLLPLGDYGGLTQTFAFGSNSPLLNAGSDALATAAGLTKDQRGANRFNG
TVDIGAFESQGYSLIPTTGDAQSTDVETAFGTALAVQLVENFVNTPLPIADIDVTFTANT
GASGASGTPTISNVVTDNTGLATSTSVITANAEAGDFTVTASSSDIEDGFFTLTNIALPP
EPEPEPEPEPEPIISETQREAIQNLFDSNESTTTGLAEQSLEESASQVIPTTQLLDTASG
AEAGSDETTDNEEECSVDGSGEGC
Download sequence
Identical sequences K9PXV9
WP_015133422.1.56710 gi|427723206|ref|YP_007070483.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]