SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427723359|ref|YP_007070636.1| from Leptolyngbya sp. PCC 7376

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427723359|ref|YP_007070636.1|
Domain Number 1 Region: 69-382
Classification Level Classification E-value
Superfamily Pectin lyase-like 3.45e-26
Family Filamentous hemagglutinin FhaB, secretion domain 0.0056
Further Details:      
 
Domain Number 2 Region: 636-762
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000000596
Family iota-carrageenase 0.093
Further Details:      
 
Domain Number 3 Region: 829-947
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000345
Family Filamentous hemagglutinin FhaB, secretion domain 0.088
Further Details:      
 
Domain Number 4 Region: 951-1071
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000439
Family Filamentous hemagglutinin FhaB, secretion domain 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427723359|ref|YP_007070636.1|
Sequence length 1322
Comment filamentous hemagglutinin family outer membrane protein [Leptolyngbya sp. PCC 7376]
Sequence
MTPVMEGNVFGATPFSEPLSLAGAHRGRKTTQKIWLFFMICWELVKRILIGSSVLFAVCG
ANGRAIADIAPDNSLGFESSVVTPNVLIRGSLADEISGGAIRGQNLFHSFTDFSIDPNQR
VYFANPSAIDQIFTRVTGSSSSDISGTLGVNGAADLYFINPNGIYFGDTAYLDIAGSLIA
TTTDSIPFVDGFAFSTDANPIPTNPLLTVSQPLGLTAWTTPQAEITNRSQLAVGNDLTFV
GQSLDLEGVLWSGGDLTLMAADNLQIRDRLDAPFITLSGGSQTLEAEIIDIFALSHPESG
LYSYGDLVLRSPNPIIIDSYFNSLGNFSLENTNGGAGDALSPNDPVIRSSGNVTFNAYSG
ASLHIFAGGSIQTGDITINAADSTNGLQEVVTLSDGSTTVNIDGQNIATLDIRAGTNAFD
SDSVVGLITPLPPFFNDPCVSGSANCFSSFPPVPPLSVLQGFSTTAPPSNADIIIGSLTF
TNGLVDNFAFISNQYEPNTNDLLRGDILLGMRLSGEPGEISLNTSGDISLVVDSRDDIIV
FGEIKPLTKGLEIGEILLKANGDLFVDNGLGSVDIDASSGKIVNDTRIGNASIDAKGTIF
LNNSIDSAGNVAINANALIAQGGNQIRTSTRDNNDAGTIFVKANQVELSGINSGGVFSGL
SSISADGSDGDAGKISVETDVLALDDGGQIRTSTFGAGAAGSIVVKANEAVTIDGGNGIF
SGIISEVGASSTGSAKLIDIQTKQLTFTNGGIISAATAGAGNAGQIKVVVDETATFDGNP
GFPLFPSGVFTESLASATGAGGSINFQAANLEITNGATIKSSTQSSNLAGDIDISVANDV
VLAGADTGIFADTSSFNVAGEGGKVTVTGRNLNMSDGGRISSSTTGESKAGDVAVNFSND
VAIAGADTGIFADTSSFNVAGEGGKVTVTGRNLNMSDGGRISSSTTGESKAGDVAVSFTN
DVAIAGADTGIFADTSSSNAANGSGGPIAVTSQNLTLTDGGRISSSTSGAANAGDIKVDV
SNDITVSGEGSGVFASTTETSTGDGGNVDIDPIFIRLSDAGRFSVSAQGSGVAGNMRVVG
DFLILDNGFIDASSQNGSGGNLTFEIGEYILLQNGSDITTNAGLSSGGGDGGNMMINVPF
VIANPNQDNNITANAFDGDGGNIEITTDALLGIAFNDEDISVRNDITVSSELGVDGEFIL
NSPDVDPSSGLAKLITDLGDRENRVVSACAAGDELNSFVVTGQGGLAADPSSFVRGSSLL
SDVRDFSGETVSTEVNEAVAVQPSEPMPTIRQATHLVRSEQGIELAATHPKALQNKVSSN
CL
Download sequence
Identical sequences K9PZ89
WP_015133574.1.56710 gi|427723359|ref|YP_007070636.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]