SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427723445|ref|YP_007070722.1| from Leptolyngbya sp. PCC 7376

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427723445|ref|YP_007070722.1|
Domain Number 1 Region: 27-311,352-381
Classification Level Classification E-value
Superfamily Pectin lyase-like 8.06e-33
Family Filamentous hemagglutinin FhaB, secretion domain 0.0092
Further Details:      
 
Domain Number 2 Region: 530-778
Classification Level Classification E-value
Superfamily Pectin lyase-like 4.19e-19
Family Pectin lyase 0.058
Further Details:      
 
Domain Number 3 Region: 736-989
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000000000000184
Family Virulence factor P.69 pertactin 0.035
Further Details:      
 
Weak hits

Sequence:  gi|427723445|ref|YP_007070722.1|
Domain Number - Region: 1007-1082
Classification Level Classification E-value
Superfamily Invasin/intimin cell-adhesion fragments 0.000518
Family Invasin/intimin cell-adhesion fragments 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427723445|ref|YP_007070722.1|
Sequence length 1571
Comment filamentous hemagglutinin family outer membrane protein [Leptolyngbya sp. PCC 7376]
Sequence
MVLRFSLLVPILSTSCVLANAVVAIAQISASNDGTGTIVNQQSDNFTILGGSLSGDGTNL
FHNFSDFNLSATQTATFLGDATLQNILSKVSGGNPSYLDGLLRVSGNDANLFLLNSAGIV
FGENAQLNLTGNFTATTALGIGFENGEWLDGNNYSMLVGAPKVFDFDGTGAIINAADLQV
NTGRSLNLFASNVVNTGTLTAEQGNIQLLAVPNTNSLRLNQSGQILGLELPMPSDSLNIV
DLAKLLTGSNLETGLVVENNAIKLASTQTPISQNSGNTFVSNLLSSAGESGGNINIFGQA
IALESATLDASGTNGGGEILVGGAFQGSGDLPRAANTLVDAESILDASAIAQGNAGDIIV
WADNATGFYGQAIATGGLQGGDGGLIETSGKNYLDVFGAEIDTSTINGQAGEWLLDPSDI
NISFTGGIGTLPDGLFNPPTSSNISPITIVNALDSGTDVTVTTSDGTGGNGDITLSDSIF
QTGAGTASLTLTGRNFTRVATSEINLTSSGGLTFNLNSVNPSTATGTELGNSLQAAHDAI
GTVAGLRTINLGAGTFARGSEISLSEEVTINGAGQGLTILDGGGASRVIDAVGAVSLQNL
TIQNGNAIYGGGIRNIGGTLNLNNVTIANNTADSGGGLYNDNGDVTIADSFFAGNIAIDA
GNDDSPDGGGAIANFGNSNLTIQRSTITGNTAINVGGGIVNYGNTLLNVQNSTISGNTAT
TAGGGIYNYSLASQATVTTLTNSIVADNIVRSDNGFGGGLHIGDQDTAIIVDSLITGNQL
NGVDSIGGGISNFGETSLTRTTVANNNARGAGGGLYNGENSNVSLQDSTISMNTTLGYGG
GIFNTGSLDIRNSTISGNTAGGYGGGVLNDNTVTLTNSIVANSVNGNDIEAGDSVGAVVI
SNGVNLVEDGSLTGTNILNLDPALTPLGDYGGPEIGDPNTGTNPLLTNFFLLDSPVIDAG
ENSAVSSFTAQRGGNRLVGNAIDLGAVEFQGVNLSITGGNAQSAVINTDFAPVTVLATEE
KFGNPLANLIINFDAPNSGASLSQKSLSGITDAAGLVNVVPSANNLVGSFNLQVGVPRFS
VSNPVAATLTNIVPPQEPDLQGIRTELEKCFGDLSCGKDEPNSNQQPNNLVAAGNQDDIL
TIANKLKKIQEQTGVNPAIVYVFFDQKSSDAVPERVYLKGSTSKEKTASKSGVDSAEWQF
NGDRLTQYLNSATVNFLNPRATLDDDAVLNLILVTPNDKVVHRTIENMTRRELVHQARIF
MRALRTLQSSASYLPPSQALHNAIIDPIEETLIAEGIDNLSFILDDGLRSLPVAALYDGE
QFLVEKYSLGLMPSFSLTNTSGYIHPKENQLLALGAAEFDDQPELRAAPLEVEIITQDIW
RRHTRAFLDQQFTLDNLLNARRNERYGILHLATHAEFIRDAPQRSYIQFQNQKIIFDEVD
KLRLGEPPLELLVLSACRTAFGDRQAELGFAGLALNSGAKSVVGSLWSVSDVGTMGLMAE
FYDKLQRSPIKANALQQAQLALLDNQVRIEEFQLRLDDRTISLPDEMREIKNANLSHPYY
WSGFTLVGNPW
Download sequence
Identical sequences K9PXR3
gi|427723445|ref|YP_007070722.1| WP_015133658.1.56710

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]