SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427723652|ref|YP_007070929.1| from Leptolyngbya sp. PCC 7376

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427723652|ref|YP_007070929.1|
Domain Number 1 Region: 35-228
Classification Level Classification E-value
Superfamily GAF domain-like 2.62e-26
Family GAF domain 0.00073
Further Details:      
 
Domain Number 2 Region: 234-352
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 0.0000000000208
Family HD domain 0.032
Further Details:      
 
Domain Number 3 Region: 439-552
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 0.00000000471
Family HD domain 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427723652|ref|YP_007070929.1|
Sequence length 564
Comment metal dependent phosphohydrolase [Leptolyngbya sp. PCC 7376]
Sequence
MTDSSPSLAQHLEQDHKALMAKIYGGSEARQRIALIEKLLAIGAALSSAHDLGELLQLIL
VKCCEITKSDAGSIYLLDSRDTDNPKLIFKAAQNFSLPDIPFKEFSLPLNPKSLAGYVAI
TGETLSIEDAYKLPDESPYHFDRGFDQKFDYRTCSVLVLPMQDQKANTIGVLQLINRKIE
SEVKITPENALHMTQSYSMWEETILRSLASQGAISIERNLLQDDIENLFEGFVKASVKAI
ESRDPTTSGHSERVALLTVGLAEEVSRISQGTLRQEYFGDRQLQEIRYAALLHDFGKISV
PEAILNKRQKLYPGDLEVIRQRFAVAKRTLQWECAQQKFQYLVEHPHAHTEGTSACPHCE
KIQKMDHEVEETLDRLDYHLALIEQFNAPEAIATKKFEILSEQVFREFTKLAKYRYRDVD
GKLKPIVNEADLEQLLLPRGNLNPAERQAIESHVSQTYEFLKEIPWTKELKNVPHFAYGH
HEKLDGTGYPRGLKGDEIPIQTQMMTIADIYDALTAADRPYKKPLPVHVVIRILREEVDR
NHLNDDLVQAFVNRKVFRVLGHSL
Download sequence
Identical sequences K9PX74
WP_015133865.1.56710 gi|427723652|ref|YP_007070929.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]