SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427723806|ref|YP_007071083.1| from Leptolyngbya sp. PCC 7376

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427723806|ref|YP_007071083.1|
Domain Number 1 Region: 1422-1572
Classification Level Classification E-value
Superfamily TPR-like 4.82e-23
Family Tetratricopeptide repeat (TPR) 0.015
Further Details:      
 
Domain Number 2 Region: 28-304
Classification Level Classification E-value
Superfamily Pectin lyase-like 1.57e-20
Family Filamentous hemagglutinin FhaB, secretion domain 0.013
Further Details:      
 
Domain Number 3 Region: 1321-1452
Classification Level Classification E-value
Superfamily TPR-like 0.0000199
Family Tetratricopeptide repeat (TPR) 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|427723806|ref|YP_007071083.1|
Sequence length 2022
Comment filamentous hemagglutinin family outer membrane protein [Leptolyngbya sp. PCC 7376]
Sequence
MNDWRQILLSLFLGIFPFVVLEVAAQPIQETNNLTQTNVTELGSDQFVINGGIVSRDGQN
LFHGFDAFNLDANQAAIFLNSPNASNLFSKISGGTPSFIDGLIGVAQGNPDLYFINPAGL
IFGKNAQLNVPSAFVGTTATALGFDNGWLNVVGSSDFANLVGEPSLFSFNTNGVVGDILV
QGNLETPVGDIGLIGGRIQGDRRISTPADLLVTTVTDQSIVRLQQPGNLLSIELDTTSLD
NGNTVDFSVNQLPQLLTGIGEIQLNEVAAQYGLIAADGQLTLNNSDIQTAGHLTLLGQGI
TTNSTSSDSGLNQLLISGELSEIYQAQKPFLTAIANKINFAIEADPIDGTPIIVTDDLID
NVTAETLNAADIRLENSLFTGQNIYILGENIDLIGSQLTTTRNLNIFGLDTVELSDSATE
KLALQSLGDLSIRGNNKLISNSFTNPDSEIASDGNLFISTGELQLREGTFESQSNFVING
DNILIQNSQLTSAQNLSVNAQNELLLEDVADQERGENFTSDKPLRLIAGNNLTLRSEEVF
RAIAPKADSLFRAGNQILVTNDDSRLDVLGNFTSDGSIQIGDRTNSTVQIEGGTWQAAGD
ISLLAQDNLILQDFHETEDNYGRIGAPLNINADQLNFAGDNLIEIYLGQNSSIKSTQDLT
LANSNNIRVTGSVASEGNLNIAARNIDIGVNLDRVGGIDGRKTLNIGQLRINVTPIVPAE
LAGARLDAFEDGRFVENMGRRFVDEAYWGGNFSAGGDLTFTAEEALTLSDYERQPLTLTG
QNIYLSGDTGQNFSPFFDQGLLFDLTNDSRSNITATKDISFESNQFIGRVGGGIISAGED
IQFFAPIIALQGSQITAGESISFTAPELLQLESLNDANLFSAIAPQINFSPSNEINIDLV
LDNLTGGKIESGSNLAISSLGNLSLSGEISAAENLSIDADNNATLVFSQLTAGEDLSITA
GGQLSLTDIRKADVRGNIFLHSPNKLITTNGDITLQGGTGLSIESYDVRSFIQSGSDTTL
ISDGTILSNIRYQVGNDFAVRDLSGSLADWESTVNVNSNNSNESLQRQIGGTFLPIGQVN
LAQINTGGDIAFNDFTGRSLILNAEGTITAGSIHLDIPVAYGFPDDGSMVRTKNHPDILL
SVTGNDPGLVPLDISIAANAADMTEENAILDGIQLNFPYVLRRFPLNLDPIPNDGDTFVA
SRRQQGIEQPGSFIIAPLSSALDFNPLLSDGLNSAGVSLNEIDNPVAQASNQSFAPITGT
RGTGLSQDLIEQQENNKAIAAISEEKPEETSIAVCTGVDFTSSENDEKFISCQQNNLRVA
KAAQDIPTQLATLGQLGSRYYQKNMYSQALAAYQERQALAQSTQNLLAEAESLQGLTQTY
SALGDYAAARDANFQTSTLLAQLEGDERSNPNQLIRLKQAIANNAGLIAYAQKSYDLAVE
QYKEGLQLAQDSGDRPTEIEILSQLGLSYFQQTDYVAAKETQSKALSLAKNEQSIPNQLR
AYEGLAIAEYALENYDVAINHFERALTLSEQVGDRHAQARNWSALGDAQYKTQQNSAAIG
SLENAIQLWEDLRANLGDQDLFRVSLFETQETTYSTLQEVLIESGQFIDALEVSERGRSR
AFVELLDRGLAPQAKTQDIDAPDIAQMRRIAAEQQATLVSYSIGRQIIDSNGQREQIDSE
IWIWVVQPDGSMDFRRQDLQAITAQGLSVEDLVSDSRCFGDRLCMLRSQSRRGGRGLSSN
GQADISDPHLAQLHQLLIAPIEDLLPTDTNKEVVFIPHRALFLVPFAALQDSTGRYLIED
HTIRTAPSIQVLDLTHQQRQKVSGEGITIVGNPTMPQGLEQLPGAETEAQAIAAIFDTEF
ITGDDATPTLVSQTIANSRIIHLATHGLLDGLGDNDAQKIPGAIALAPTEADDGFLTASE
ILELKLNSEMVVLSACDTGRGTITEDGVIGLSRSFMGAGVPSVLVSLWQVPDESTSDLMI
EFYGQLQSNPNKARALRQAMLANLQKYGQPRDWAAFTLMGET
Download sequence
Identical sequences K9PZK1
gi|427723806|ref|YP_007071083.1| WP_015134016.1.56710

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]