SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427723832|ref|YP_007071109.1| from Leptolyngbya sp. PCC 7376

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427723832|ref|YP_007071109.1|
Domain Number 1 Region: 31-208
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 4.71e-74
Family HD domain 0.00000181
Further Details:      
 
Domain Number 2 Region: 197-412
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 1.63e-62
Family RelA/SpoT domain 0.0000195
Further Details:      
 
Domain Number 3 Region: 395-467
Classification Level Classification E-value
Superfamily TGS-like 6.38e-21
Family G domain-linked domain 0.078
Further Details:      
 
Domain Number 4 Region: 667-746
Classification Level Classification E-value
Superfamily ACT-like 0.0000000000323
Family AF1403 N-terminal domain-like 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427723832|ref|YP_007071109.1|
Sequence length 749
Comment (p)ppGpp synthetase I SpoT/RelA [Leptolyngbya sp. PCC 7376]
Sequence
MAVSPIPVPEKFDIPLPSWLKDYLYGGGVQEISVGDRQLICKAFRFAHELHEGQERKSGR
PYIEHPVAVAGLLRDLGGNSAMIAAGFLHDVVEDTDVTPEEIEEHFGEEVRQLVEGVTKL
TKFTFSSKTERQAENFRRMFLSMAEDIRVIVVKLADRLHNMRTLEPLRPDKQKRIALETK
EIFAPLANRLGIWRFKWELEDLCFKYLESEAFRAMQDHISEKRAEREARVNEAIDIVRDR
LHKLKLHVWEIKGRPKHLYSIYDKMQRQHKEFDEIFDISGIRVIVESTDECYRALAVIHD
AFKPIPGRFKDYIGLPKPNRYQSLHTTVVGLNGRPLEVQIRTMEMHHIAEYGIAAHWKYK
EVGHSNASISSTDEKFTWLRQLLEWQSDLQDAKEYIDNLKDNLFEDDVYVFTPDGDVIAL
AKGATSIDFAYRIHTEVGNHMKGARINGRWSVLDTTLKNGDIVEIITQKNAHPSLDWLNY
VVTPSAKNRIRQWFKRSHRDENLTRGRSLLEKELGKSGFDSILKSDDMQAVAEKCNYQST
DDLLAALGYGEVTLKHVVNRWRDMVRDQEEEHLPQFESEADLNPTKTPKSLTSDNHKYPI
AGIEGLVYSLAGCCSPLPGEPIMGVVTRSHKGISIHHRHCNNMRNFEGDRLIPVHWNPNH
DHKSSPVYPVDLSIEVIDRVGVLKDILTRLSDQNINVRKAGVKTSHSKPAIISLSIDIRD
AQQLNASMNKIKNMSDTLNVRRVSQVEHD
Download sequence
Identical sequences K9PXR2
gi|427723832|ref|YP_007071109.1| WP_015134041.1.56710

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]