SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427724002|ref|YP_007071279.1| from Leptolyngbya sp. PCC 7376

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427724002|ref|YP_007071279.1|
Domain Number 1 Region: 44-335
Classification Level Classification E-value
Superfamily Pectin lyase-like 6.59e-25
Family Filamentous hemagglutinin FhaB, secretion domain 0.0069
Further Details:      
 
Domain Number 2 Region: 1260-1434
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000000753
Family Filamentous hemagglutinin FhaB, secretion domain 0.075
Further Details:      
 
Weak hits

Sequence:  gi|427724002|ref|YP_007071279.1|
Domain Number - Region: 1434-1483
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000628
Family P22 tailspike protein 0.074
Further Details:      
 
Domain Number - Region: 1138-1218,1253-1282
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00188
Family P22 tailspike protein 0.071
Further Details:      
 
Domain Number - Region: 1655-1877
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00207
Family Filamentous hemagglutinin FhaB, secretion domain 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427724002|ref|YP_007071279.1|
Sequence length 2004
Comment filamentous hemagglutinin family outer membrane protein [Leptolyngbya sp. PCC 7376]
Sequence
MDKSVVASVNIQLMGPVLCCLSLQTLTAQAQIIPDAALPPGVRPTLQFQDNISGQITTLI
NGGIFQDNKLLHQFSDFNINPDDLVYFDYSDQLGTVETIFTRVNGNNTSTISGTLGVLGN
ANLFLSNPNGIIFNNGAKLDLNGTFLATTAQDLNIENNTVNLLEASPQELLSINSNALFS
NALSNYQGDITQNGILNLNPSQELSLIGKTVIINGEIQSAQGDLNILGDRLIFTDTALLD
VSAPNGGGNLIIGGHPKNSSLPTANQVAITPDATFLANAIEQGNGGDIIIWSDGQTLFTG
NISAKGGRDDGNGGFIEVSGQNLVFRGQVNTTAPNGNIGTLLLDPVDIEIRDGSNDGNDN
GTLSNAFGNDPLGSNGTVLGNDPTPTIIYESELESLTETTSITLEATNNITLKPLASDGI
LEFSNLLPFFPGQAIIFRANSDGIDGGNFIFEDPTNTIKTNGHSLTISGNELILGNLDTD
AFFGGRLTLNSLDGDINVLGKISTENTVTMQSIGGSINLQDFDASGLFFFGNLDFSVDLK
ADNNIQLNGDIAPMGTFRAIADFDQNGMGDFIVTDPTQIIATYAGTEITAQNIQLGNLSD
IANITLNAAHNIQLENILPVPTNIANTFPVLTTIGPTVEITAGRALQGQQISTAPSDFVI
PFGGVFNGGDLNIRVDNDLNLNNIETLGGTVDIETLGEIQINQIKTNETDTIPAVESPGN
IQVKTPEKVFIDTLQTSSNEFSSIGGNINIIGDAGIEIHTIDSKGGALGGNISLAASKGD
ISTNNIQTVSIGSFGTSGDVNISSGGNISVENIRTETFGFLGDSGDVNISANNNIIVNQI
DANGNFLVSTISPNSVYINAQGSIDILNHIHASAGRSSDIQLVAGTDISTGNLLSNYTSD
EGTISLEAGNNITTQNISLKLLNDSNTLPNRVPLAINHVDIQAGNNVITEKINTSNSNQG
RNVGISAGGSVQTDDITTTSTALNLDSAALFSNDYSIRSGGAGNVFVQAIADVSLGNIDT
TAERGIGGNVTLTSAGNIQTKTIKAIGGFERGGDIFIQASGNILADDVIASGNAGGNILL
DAAQTLQATNLESQARRLFLSNTEVGDFIGIDLTAFNESMFADLVNTIPQDQIVDVLGII
NLGDGGNIQLKSGNQLIFQRTTTDAINGDAGNIKIQSEVPLILNNAEITANALGQGKGGD
IQLQAPIIQFDNTRLSSAIAEFGTTGEISLTASDRITLTNNSQISNEISIGAVGDSKGIQ
LTAPTIQLTNNAYVDSSTFGFGQAGNIEFQVDNLSLENSGILALTAGQGDAGSLDIRGFS
QGAAQEIHLDQSQLSTAVSDRTVGNGGDIQIFGDRLLLENGSQIQALTKGTGTSGAINLI
LNDELTIAGFDQNGFLSGVFTSSEAADSGQGGKLTVQTDKLNLSNAGILSSQTFSSEAGG
DIQIQAKQATLNSGGQIVASTQGLGQAGQIELNISETLTISGTDPSFGDRPIPAIPPVIP
LRGTLPTFTSESTNNNSLAAAQTINADFILDPLDDPQPNLLGSTFSPYVVIAGQGEDAID
IYRFDAGAGTRGIFDIDFSTADTKLTLLDEQGNTLATNDNASPLLGGRGTDPNIQPVTQL
VSIVNGAAFVFFIPVGGDVSPENRDPYISYAFNETGSYFLQVESLSGNTGEYTLFSSLRS
PNVSGSTVNAGNRSGIFANTSGLGNAGDIIANIGQNLIIDQGGAIAANTLQNSFGDSGNI
FINAPQIQVLNQAGIEVNSLGQGVGGNIQIRGELLELAQLGHITAETLSSDGGNILIDLN
RALLMSDASVISATAGLNGLGGNGGNIEINVPFWINFPGATNQAIANAFAGNGGNINIST
NSIFGRQYLNISASSRLGLDGSIIIDTPNIDPTSGLVELPENFTDPSNQIDEACQTNRQN
SFVLSGRGGIPESFEQSLWETPTWIDLRSPQHQNTTAPDISTILPLDLQPNYQATTLKKI
PASNKFKLVGHTLPSTQTLTTSCH
Download sequence
Identical sequences K9PYA0
WP_015134207.1.56710 gi|427724002|ref|YP_007071279.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]