SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427724071|ref|YP_007071348.1| from Leptolyngbya sp. PCC 7376

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427724071|ref|YP_007071348.1|
Domain Number 1 Region: 575-670
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 0.00000000000314
Family HD domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427724071|ref|YP_007071348.1|
Sequence length 796
Comment 7TM receptor with intracellular metal dependent phosphohydrolase [Leptolyngbya sp. PCC 7376]
Sequence
MNFWSSFKHYWQNATIVQTPRANTGLNQTQRKQATYSSAAIAVLTVVACTGIIGERFYNQ
PQLAVDTIAPRKIVAPIDGEFEDPKTTEEKRQEIRTGSIPSLKRDIDATSAIKQDIRNVL
SDITRIRNIAGDFPFIELEILSIPSQVGLRQLSDEQWQEFVAIADQLTQEEVPPLGRLMP
NDIDIAPPLRELYTYSQNQDRATAEVQQLMARIQIARESFQQAEQAANEAEQILFRRHQS
LLLRLSSTQWADAQTQLLKVSDRILTQGIPKGIADILLKETIQVQIDNEEIASPFVVDVL
STHLRPNLIEDKEETKRRSEQAALAIEPITVSVSAGDVIVDRGETIDQSAFVLLDGFGLS
NRQINWWGLVGYAVMVSGSVVLMVLVIRKVHRPMRCRDHLLLALISLSTPLLVFFDVPYS
NLSAVGLLTSSLYSPAIAFTQVSVLSGIVAVSSETLQWQYLVTGTVGGLIAAFLGGRLRS
REEQATMSGIVGISQTLVNFSLSLIASASAGTLWYVFLPEAALYGFSGTAWIVVALGISP
YLERLFDLVTPIRLAELSNPNRPLLKRLALEAPGTFQHTMFVASLAEAAARELSCNVELV
RAGTLYHDIGKMHDPLGFIENQMGGPNKHDVIDDPWKSTEIIRKHVTEGIVMARKYGLPQ
AIRDFIPEHQGKLLISYFYYQAKNQYQAEGKSIEMLNEQDFRYVGPIPQSRETGLVMLAD
GCEAALRSLKDATPEQAIIMVNKIFRARWQDGQLDDCGIRREELSYIAEIFVRVWQQHNH
QRIAYPKAALEPQSKA
Download sequence
Identical sequences K9Q0D1
WP_015134276.1.56710 gi|427724071|ref|YP_007071348.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]