SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427724079|ref|YP_007071356.1| from Leptolyngbya sp. PCC 7376

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427724079|ref|YP_007071356.1|
Domain Number 1 Region: 250-624
Classification Level Classification E-value
Superfamily SIS domain 1.21e-99
Family double-SIS domain 0.000000159
Further Details:      
 
Domain Number 2 Region: 2-240
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 3e-67
Family Class II glutamine amidotransferases 0.00000226
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427724079|ref|YP_007071356.1|
Sequence length 624
Comment glutamine--fructose-6-phosphate transaminase [Leptolyngbya sp. PCC 7376]
Sequence
MCGIVGYLGTQAATDILVGGLERLEYRGYDSAGIATIWDDQVHSVRAKGKLYHLREQLEN
QQTPSQIGIGHTRWATHGKPEVHNAHPHLDMSQRVAVVQNGIVENYRELRLELQEKGYNF
LSETDTEVIPHLISDLLKETVGSDEPFLDAVQKAIARLEGAFAIGVICADYPDELIVARQ
QAPLTLGFGQGEFFCASDITALIPHTSAILTLENGEMARMTPLGMEIYSFAGERLKKTPR
TLDWNPVAVEKQGFRHYMLKEIYEQPAVVRTNIEAYLNLDAEHPINLSINPPEFLDNIDH
IQIVSCGTSWHASLVGKYLLEQLAGIPTFVYYASEFRYSPSPIMPNTLTIGVTQSGETAD
TIAALEMEKERRSHRTDAKFKPRLLGITNRSESTITQIVDQVMFTHAGIEIGVAATKTFE
AQLMSFYFLAMELAARRKALSSVEISALIDELKQVPAQIESIIEEQEKDIEELAHAFVDT
NDFIFIGRGINFPIALEGALKLKEISYIHAEGYPAGEMKHGPIALLDTKVPVVAIAMPGE
IYEKVISNAQEAKARDALLIGVTASNDQEAGHTFDKVLPVAPVKEILSPLLAVIPLQLLS
YHIAAHRGLDVDQPRNLAKSVTVE
Download sequence
Identical sequences K9Q184
WP_015134284.1.56710 gi|427724079|ref|YP_007071356.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]