SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427724087|ref|YP_007071364.1| from Leptolyngbya sp. PCC 7376

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427724087|ref|YP_007071364.1|
Domain Number 1 Region: 32-350
Classification Level Classification E-value
Superfamily Pectin lyase-like 8.16e-29
Family Filamentous hemagglutinin FhaB, secretion domain 0.0086
Further Details:      
 
Domain Number 2 Region: 911-1037,1085-1115
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000173
Family P22 tailspike protein 0.066
Further Details:      
 
Weak hits

Sequence:  gi|427724087|ref|YP_007071364.1|
Domain Number - Region: 845-891
Classification Level Classification E-value
Superfamily TIMP-like 0.0306
Family The laminin-binding domain of agrin 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|427724087|ref|YP_007071364.1|
Sequence length 1414
Comment filamentous hemagglutinin family outer membrane protein [Leptolyngbya sp. PCC 7376]
Sequence
MNRASNPITTTFSFSRWVALLTGVAVGTIVSEVPSQAQLLPDNTLEAESSIVSPDNIIHG
GATRGSNLFHSFSDFNVETGQSVYFANPVGIENILGRVTGSNVSNIDGLLGVHGTANLFL
LNPNGVIFGDNADLDISGSFITSTANSFTFADGNKFSATPATGELLTMSVPLGVQFNNQP
QGDIISVGLLETGQNLMLQGQNLYLEGKLLAGNDLSLHATDTLRIRDTATDPFTARTGRS
LTLQGDQGIDILALQHLEQTPFISGGNLSLISDGVISADAHFASVGNLQFLNRNGGPGNI
VSYYDPIISAIGDVVFGNYTGAALKVEATGSIQGGNIRIFGPDTTLIADGSGSDEDLLAS
SRAAILRAGVDALSLDTLPQTAEGTNFSAGVVSGQPAGSIVVGSINTSNQFMGDGGPIIL
EAKGNIITTDTFDDVFGFPTSLGSFASSNSVTAGSGGDIRLSALAGEILTGNIDAISYVG
GPGAGGDISILALGDITAEDVSTITVSNDGGVGGNIEITSMSGAVAVEDIFSAANNSPGS
AGSGGDVTISASGDILVDGEIFARSDAEDGSSSKGGDIQLSTISGDITVREPIDTNSFAF
GGIADRAGNVAISSQSGDILLIGGYYSVIGARSLSQPYGDGASGGNGGNITISSTSGNID
IRQDPRRTNAEQIAGILSGSFGETVDAGSGGDIVIASTSGDITIDASIDTYSSSETRTAG
VGGNITISSQSGAITLTQSLSSASQAPDVDDVSFGSNKISIESGSGNIFTSGSIASLTTS
NGLTGIAIASQSGDIEINSSLVAQGSDIRIRAPQGSLFGDNAVFATSFGNPDSGSIRIDA
GDTISGLELITLASAGQSGIVDIQGFGDLRITDTKVVTGAEVTYILPPSSPMSPPRIITQ
SIGEEGQSGDTFITSTGNLTLENVEILSDTFNSNSGGDIGIQDAKSVVLRNSQLQTRTNN
IGNAGNIFVEDASTAMIDATQLLASTSGSGAGGNVFLEIPTIQFDNNAQIAASTSGSGSG
GNIIFDSGSDTLTLSGDGTISVETSGTGQAGRFVDKDNFEAGRFLLQIPFITIDGVELTA
STSGIQDGGDIEIQTTDLSFANGGEINASTSGSGNGGSLTVNGNSPLTLRGDGRLTVASL
NPMGGRAGDLIVHNTSILALRDGVELSAESASELGGGNVNINVDNHLFLTGGSLINASSS
NANAGDGGNVLIRLGDGFLIARLEQNNDIIANAVGGNGGDIGVSALQIFGFTEQSNSTFS
LLRSNLTNDISASSEFGLNGVITLSTLDLDPSQGLTELPATLGDRTDQIAAGCDLGNSEK
QSEFVVSGRGGLPSSQNNLIGAGGVSVPWVLASDDEPIALMDQTQLPTSATLEEAQGVAI
DAEGNTHFVAHRNVLASPEIQAASSDFCQMAHQL
Download sequence
Identical sequences K9PYH7
WP_015134292.1.56710 gi|427724087|ref|YP_007071364.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]