SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427724089|ref|YP_007071366.1| from Leptolyngbya sp. PCC 7376

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427724089|ref|YP_007071366.1|
Domain Number 1 Region: 31-343
Classification Level Classification E-value
Superfamily Pectin lyase-like 1.22e-35
Family Filamentous hemagglutinin FhaB, secretion domain 0.0092
Further Details:      
 
Domain Number 2 Region: 482-651
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000000000000753
Family iota-carrageenase 0.077
Further Details:      
 
Domain Number 3 Region: 351-473
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000847
Family Filamentous hemagglutinin FhaB, secretion domain 0.072
Further Details:      
 
Weak hits

Sequence:  gi|427724089|ref|YP_007071366.1|
Domain Number - Region: 652-764
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000173
Family Filamentous hemagglutinin FhaB, secretion domain 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427724089|ref|YP_007071366.1|
Sequence length 1002
Comment filamentous hemagglutinin family outer membrane protein [Leptolyngbya sp. PCC 7376]
Sequence
MNCPSHPIKTTLLCFRWVALLMGVIVGTILPKVPSQAQLQPDNSLGTESSIVSLDNIING
GATRGSNLFHSFSDFNVNAGQSVYFANPVGIDNILSRVTGNNVSNIDGLLGVNGTANLFL
LNPNGIIFGENAALDISGSFTASTANSFQFTDGSEFQATPLAGELLSMSVPLGVQFNDQP
QGILTDKAGILVGSGSTLTLLGKKEESNKDTLLIRAEDLIIENTSTSNPTVPIISALTIE
EQLFSYAVILQAINTLTINSSVQGFRDNDLVLEASNIEINNELGQNNGGDIRLITPQIEG
NAISINGALVSTANGDETISGGNIGVITHDFTIQDDARLMVQTISDNGKGGGGIFIDASG
DLSVQTFSSIQSAALFGGAKSGVIDITADNLVVTDSSSISTSVDTFNNLGGFGNSGDINI
VAVNNLEVSDGSEILSQVSDGATGNGGFISITTPQLTVSEASFISTSTLGTGNAGNMLLN
VFGDVFVTEGGAIESQVANSAMGNGGRIDLIASSLNVIAGQINAATEGIGDAGNIVINTS
GDVTISEFSGLNSQAAFGSTGDGGTIEINARNLKIADESFLAASSLSDGDAGDISINVAE
DVSVTGFFSAIESQVAFENSLGDGGTIDINARNLEVADQAFLSVSSFGEGNAGNIIIDVS
ETVSVTGEFTFIESLVSGNGDGGSIEITTTELILSDGSLISASTSGSGDAGNLTILGRSP
LTLRGDGKLTVESLEATSGSAGTLTIGNASDLAIRDGIVLSAESASENGGGEIIIDIDNH
LFFTGGSLINAGSTNPNSGDGGNITIRLGNGFVITPPGQDNDIIANAVAGERGNIDITAL
QIFGFTEQEESRTELLRGNGSSDLGASGVITLSTLDLDPSQGLVELPAVLSDRTDQIAAG
CDLNHSEDQSEFVVTGRGGLPLNSSTLGNAAGVSVPWVIASDDESLALVGQQSSSASPTL
VEAQKVAIDTMGNLSFVVPQDSIAHSEIQASTSDFCQVNHQL
Download sequence
Identical sequences K9Q192
WP_015134294.1.56710 gi|427724089|ref|YP_007071366.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]