SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427724122|ref|YP_007071399.1| from Leptolyngbya sp. PCC 7376

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427724122|ref|YP_007071399.1|
Domain Number 1 Region: 2-250,353-418
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 6.95e-74
Family Succinate dehydrogenase/fumarate reductase flavoprotein N-terminal domain 0.00000537
Further Details:      
 
Domain Number 2 Region: 442-575
Classification Level Classification E-value
Superfamily Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain 5.89e-46
Family Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain 0.00015
Further Details:      
 
Domain Number 3 Region: 227-349
Classification Level Classification E-value
Superfamily Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 4.64e-40
Family Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 0.0000437
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427724122|ref|YP_007071399.1|
Sequence length 575
Comment nitrate/sulfonate/bicarbonate ABC transporter substrate-binding protein [Leptolyngbya sp. PCC 7376]
Sequence
MLQHDVIIVGGGLAGCRAALEIKKTNSNIDVGLIAKTHPIRSHSVAAQGGIAASLKNVDP
EDSWEAHAFDTVKGSDYLADQDAVEILTKEAPEVIIQLEHMGVLFSRLEDGRIAQRAFGG
HSHKRTCYAADKTGHAILHELVNNLRHNGVTIYDEWYVMNLIFEENQAKGLVMYHIETGK
LEVVCAKAVMFATGGYGRVFNTTSNDFASTGDGLAMTAAVGLPLEDMEFVQFHPTGLFPV
GVLISEAVRGEGAYLRNSDGDRFMEKYAPKQMELAPRDITSRAITLEIRAGRGIKPDGSA
GGNFVHLDLTHMGKDKIMSKVPFCWEEAERLVGIDAIVEPMPVRPTAHYSMGGIPVNTEG
RVRKNGTELTEGFFAAGECACVSVHGANRLGSNSLLECIVYGRRVGSKIAEYIGDRPLPD
ISEKDYLEAAKTRIKKLIDQTGKTRIGDLRQRFQDTMSEHCGVFRTDEIMSEGIQEIQSL
KAEYNDVFLDDKSTHWNTELIEAMELQSILKVGEAILTSAYNRKESRGAHSREDFPIRDD
KKYLGHTLSFCSEDGVDIEYMPVVVNRFEPKERKY
Download sequence
Identical sequences K9PYL3
gi|427724122|ref|YP_007071399.1| WP_015134327.1.56710

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]