SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427724142|ref|YP_007071419.1| from Leptolyngbya sp. PCC 7376

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427724142|ref|YP_007071419.1|
Domain Number 1 Region: 43-322
Classification Level Classification E-value
Superfamily Pectin lyase-like 7.53e-31
Family Filamentous hemagglutinin FhaB, secretion domain 0.018
Further Details:      
 
Domain Number 2 Region: 676-942
Classification Level Classification E-value
Superfamily Pectin lyase-like 2.76e-18
Family Pectate transeliminase 0.037
Further Details:      
 
Domain Number 3 Region: 525-714
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000000000000243
Family Galacturonase 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|427724142|ref|YP_007071419.1|
Sequence length 1596
Comment filamentous hemagglutinin family outer membrane protein [Leptolyngbya sp. PCC 7376]
Sequence
MLGAKTEVLVLFRSNISFFLLAIPTLPFVFLEPQQQAIAQITPAGDGTGTIVNQTGSDFE
ILGGSLSGDTANLFHNFSDFNLSPSQSATFFADPNIQNILSRISGGNPSFIDGLLRVNES
DANLFLVNPAGLIFGANAQLDIGGSFTATTSTRIGFGEDFLQSFGTNNYAALNGNPTSFV
FDDATGMILNQGNLAVPANESLWLVGSSVLNLGTLSAPNGNISLTAIPEQRQIKISQPGN
LLSLALDAAPIGGTLLPNDLQVFTTTDLPQYLTGSSETVSVGETGEVSLKQNGENIAFNA
GDVGIAGTVQADTVQLMATGRVTPTDFSLIEAGESSRGGLTVVRFRDNLEDSLGYTFIDQ
RADNPDQLLFGGESGTIATIVLKQEAGLDAVTNALLEFAATGETLDAINIVAEGNEGYFW
LGSDLVDGATLEAYQAQLQQWRSVLGNGADLLLYSCFTALGMDGEALLTQLAELTETDVA
ASLDVTGSAEFDGNWDLEYSTGDIEASNPFTLETLATWEGRLATILVQNLNDNGPDSLRE
AFSAAVAGDLIIPTISGNVVLTTGEIAWTTDNLVLDGTGQFFAVDGNGSSRIFNILAPTA
TIEDITIRNGSAFNGGGIFTAGTGIVNINNSIISGNTASTGAGIYTNIATVNINSSTVSG
NMASLNGGGIQNSLGTVNINNSTIENNSASNLGGGISNDGTVNINSSTISGNTSSFFGGG
IYNAGTGIIDVNDSNISNNDASAGGGASNFGSLTINNSSIFSNSASSGSGGGIDNVGTVN
INNSTISGNTATTSGGGIYDLSGIVNINNSTISGNSTQPAGGGGVRRAGGGTANLTNSII
TNSIGGDWSGATPTVFGFNLVQDGSVAGAGVLNVDPLLAPLGDYGGSETGDPNTGTTPLQ
THLLLPSSPAFDVGDDSFVSSSFEQRGGDRQVGIVDLGAVEFQGTELFILAGDNQTALTN
TAFSQELIVFAEEAIFGNSLEGIDVDFLAPVTGASTNPIDFFTVTDIFGEAAFPASANGI
VGAFDVFVFADTGIVVFTLNNTDDVTLVSEGETFTDPFIDLFLDPFLNSFFEDSDFIIEE
DTGIFGEGSEGIDTVDSSEVIAEGIDDSSITADNPEEGSDGVDNEDSEIGGTTPEVGGQN
KPDAIVTNGDTFLTAEVEQAAEYGDYLGQNLPSPFTPEQSQSLLGNLDAQTDTKTAYLSL
RFRPISNNLASDNEPQSVQLSRTKNNHKIDTLKPWLGQIPGQTNGEDPLEVIITTANDEI
VVKTLPITRRQLKQLERELLRVAITPNQIFRRRLDRALESIHQQVFEPIEETLREEEISN
LLISLGRDLRSVPWAALYDGEQYLIEKYSLSITPNLSLTDTSYRPLHDREMLAMGASSFS
ELNDLPAVPTELELITQQFDNSRYFLNEEFTEENLLAARDEINPGIIHLATHASFQGGNL
QNSYIQLWGEEQLAISEMKQLQWFREPPVELLVLSACQTALGNPEAELGFGGLAIQAGVR
SAVASLWEVSDVGTMALMSEFYQNLRDPNIRTKAEALRQAQIALIRGDVRIDGNQLRGGT
RSPYSIELSGNFTAPTSNSLAHPYYWSAFTLIGSPW
Download sequence
Identical sequences K9PYN4
WP_015134347.1.56710 gi|427724142|ref|YP_007071419.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]