SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427724183|ref|YP_007071460.1| from Leptolyngbya sp. PCC 7376

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427724183|ref|YP_007071460.1|
Domain Number 1 Region: 340-638
Classification Level Classification E-value
Superfamily Pectin lyase-like 4e-16
Family Galacturonase 0.0078
Further Details:      
 
Domain Number 2 Region: 629-853
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000000476
Family Galacturonase 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427724183|ref|YP_007071460.1|
Sequence length 1109
Comment hypothetical protein Lepto7376_2342 [Leptolyngbya sp. PCC 7376]
Sequence
MFTQRFLSRQIIILSSILGIGLYVFPVRAQENPVSNTTKKQLVSPRFSGTFQTGEGAGYE
ASFGSFYGFVPFSQTPGVSTFYGEGRFNGFTDGGGQGGNLRAGYRRFLSENNLVIGGYAG
WDLRHTESKETFHQLGLGAEVLGDKWEARLNGYIPLGDASRTISSDTTTNTTTSNFRFLD
NRLLFDSQSQQLISTLSENAMTGIDLEGGYQLSKWDTGNLYAYAGLYFLDGEGTSIIGVR
SRLQAETESLLAGISLQSDSNFGTNLQFSLGLKLGGENIRKRSETPEESVIARLGQSVQR
QDIIPIDRQQELETQIEQSNDVVARNPVTGDEWRFLHVTDGVTTGDGTFENPFGEVTDAS
AIAMTAGNDVIYVESGDRSGMAGFTVPDNVQALSTGVTQELDIVDVGITQLPGSGTGTSP
LVQDTVTMGNGSRLSGFDIQSGNNPSVYASNVSDFTIDRNTISTTGNDADGIEILGDGAT
ISNVLLSANTISTMGDSAEGIDIEGNASTISNTIISGNTISTTGEGSEGLDVGSYNSTTT
SDTTISGNTITTQGDRSEGIDIEGYNSTISDTTISGNTVSTSGFYSEGIDVDSYNSTISN
TTISGNIVSSTGNYLANIDVSGDYSAQITNTIISGNTVSTAGNYTTGIGIFGNDSTIINS
STISGNTVSTTGNYYTNGIGIFGNDLTAITSSTISDNTVSTTGNYLTSISIYGDRGTTVS
GSTISGNTVSNSGDYTSGIGIYGDRDTTVSDSTISGNTVSSGGNYTTGIGLYGDRGTTIN
SSTISGNTVSSNGTYADNISVYSDVMSIINGVTIATNTITANGDESRGFSTRTRNGSTLE
NLTVSDNNITVDGQNNRGIITRTLNGSMMTSTQISGNTIAANGDGGRGISVRTLNGSTTD
GVNLASNTITTSGTTNHGISVRTLNGSNVDNAEVSANNVITTGNGAHSLFVGTSNIGTTT
TRLMLSDNTLMTSGTAAEGLFIRAFNDGTIDEITVSNNVITTSGNNSNGLFVRSNNGGLT
NDVSVLNNNFQQAGANSVRLQDAAPPLGICITAFTNNTSGTADFAGNGGDDLLIGAAGNI
NFVDFADVMANNTGFVDISGTPDTSVPCP
Download sequence
Identical sequences K9Q0D6
gi|427724183|ref|YP_007071460.1| WP_015134387.1.56710

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]