SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427724387|ref|YP_007071664.1| from Leptolyngbya sp. PCC 7376

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427724387|ref|YP_007071664.1|
Domain Number 1 Region: 264-477
Classification Level Classification E-value
Superfamily PRTase-like 4.98e-72
Family Phosphoribosyltransferases (PRTases) 0.00000134
Further Details:      
 
Domain Number 2 Region: 20-270
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 1.12e-64
Family Class II glutamine amidotransferases 0.0000038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427724387|ref|YP_007071664.1|
Sequence length 489
Comment amidophosphoribosyltransferase [Leptolyngbya sp. PCC 7376]
Sequence
MTVPQTVSADLQSDKPKEYCGVFGIYAPTEEVAKLAYFGLFALQHRGQESAGIATFDRER
VHCHKDMGLVSHVFSEETLNELPGIWAVGHNRYSTTGSSHSCNAQPALEETRLGTLALAH
NGNLVNTIELKEKLHSLSDNLDFYTTTDSEMIAKAIAIYVNQGMDWHDAAIAAFKLCSGA
FSLVIGTPDGLIGARDHYGVRPLVIGILEEEDGSERFVLASETCALDIIGAEYLRDVNPG
EMVWITEEGLQSTQWSEAPDKKLCVFEMIYFARPDSVFHDETLFSYRLRLGAQLSRESNI
EADLVMGVPDSGIPAAIGFSRASGIPFGEGLIKNRYVGRTFIQPTQHMREVGIKMKLNPL
KDVLHGKRIIIVDDSIVRGTTSRKIVRALRQAGAEEVHMCISSPPVTHPCFYGIDTDNQD
QLIAATKTQQAIAEQIEVDSLTYLSKEGMLKVTNENPQHFCTACFDGNYPIEIPDAIKSS
KLMLEEATV
Download sequence
Identical sequences K9PZE8
WP_015134587.1.56710 gi|427724387|ref|YP_007071664.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]