SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427724388|ref|YP_007071665.1| from Leptolyngbya sp. PCC 7376

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427724388|ref|YP_007071665.1|
Domain Number 1 Region: 32-223
Classification Level Classification E-value
Superfamily PHP domain-like 1.83e-40
Family PHP domain 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427724388|ref|YP_007071665.1|
Sequence length 229
Comment PHP domain-containing protein [Leptolyngbya sp. PCC 7376]
Sequence
MTFTLSTATAAQDVQALKGAWRKITPTSCPLHYNFHMHSVFSDGQLTPKEIVDQAIAIGL
SGFAITDHHTVKGFFSAQAYLAEQNENSDRSLPKLWTGIEINGVLGETKVHILGYGFDPT
HSALKYYRQREIQRGERANAEVIVKAIHQAGGLAVLAHPARYRRPAPELIPTAAALGFDG
IEAYYAYDNPDPWHTSVKHTATMKAIGEKYELWLTCGTDTHGRSLRQRI
Download sequence
Identical sequences K9Q103
WP_015134588.1.56710 gi|427724388|ref|YP_007071665.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]