SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427724427|ref|YP_007071704.1| from Leptolyngbya sp. PCC 7376

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427724427|ref|YP_007071704.1|
Domain Number 1 Region: 128-421
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.38e-78
Family WD40-repeat 0.0000339
Further Details:      
 
Weak hits

Sequence:  gi|427724427|ref|YP_007071704.1|
Domain Number - Region: 454-497,894-960
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0101
Family Nucleotide and nucleoside kinases 0.065
Further Details:      
 
Domain Number - Region: 1077-1188
Classification Level Classification E-value
Superfamily PhoU-like 0.0488
Family PhoU-like 0.018
Further Details:      
 
Domain Number - Region: 465-595
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0532
Family ABC transporter ATPase domain-like 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427724427|ref|YP_007071704.1|
Sequence length 1262
Comment KAP P-loop domain-containing protein [Leptolyngbya sp. PCC 7376]
Sequence
MQKSDLTQSETINFAKHPELVSSFKTILGEIETVIDVLQREDLDFELLVKTNQGLLQDLR
LAINKYPEVEEYYQQHLEELGELNSLEGFFKNPEYVLENRRNFIDHFKVIHQCIEKPLND
TNRIEEKQINYRIFKVLYGHKSGVSSVDFSPDSQLLVSGSFDSTVKIWNLKGENLQTFTG
HQSGILDVAFSPDGKIIASASKDQTVKLWTLQGEELLTLRGHSEWVWGIDFHRNGKQLVS
VSADKTARIWDISGLNNFNHDPIIIRGHSDRIHDVTYSINGNGDTFITASDDGTVRFWNQ
EKAILKPFSHSDRVRSVCSSYHGVEIYTGCSDRKLRSWTLNGELLFESSGHRLGVDSVTS
HPKGFFIATGSADKTIRFWSTQGKALKTIQGHEDRIWDICFSPDGNLLASASDDRTIRIW
QHNDSLETINLVPQGISNDLAQGDDQLSIEDELQAIADVLLLRQLEPPIAVGILGTWGSG
KSFGMHLIQQRVNEIRCSNRQLVEAWGEGLEEDDPDREKKLSPYVGHIYQIKFNAWSYAK
QNLWASLMQEIFSELNQQITFERQLQQAGVDLLSGGQLWEVLENLNTGDHQYFLEQNLDP
ETFERLRNIELKSELKNELLETLRRSQNQVQQDIKEQETLLQETKQALKKRQCEIAEGMD
NNLNLALASSPDLIKQVHKHFGKNVELKITESIRAKDPDFDPQNVKDLINVFGESANLFL
GDRKPEVFSFPSLRRWLPRVWRPLLIFLLLVFICILIPWKFYPWLNQLLAAKSDSTTWSF
ITSAFGMLGFGTPASFKARDLLTNFNKWSKDANLTIQETQKKLQQEMRAAVEQDEQAQKL
NTQLTTLKKDIESKKQKLPELQYDSLAEFLGDRLKPENYTDMLGMINQVQQDLQDLSDKL
LPPKEKRDEKIKDLFPRGEPRVILYIDDLDRCPPDRVVEVLETVQLLLKTQLFVVVLAVD
DRYIARALEEVYSGVLKRRGKPSGIDYLEKIIQIPYRMRPISSDTIEQYLGSQINVLENI
PTEIPTTEQKSLPPALEQEPIQTTATQKPITSSQQTNDAAIAQQDFSQAQTIELPPIELE
PEVDSVTSELGSNINEINTIEQAELDLIVKCCQYVDITPRTGKRLINIYKILKIIWQKRQ
EPTPETKQVLFSFLALSGRYPDFMRNLFEEIDTELQEKLDETDNQLDYKDLLNSIYPQVP
ERDYHAQREWRKFKTDISQMIPTNPFILNKDDFELALSFCFVGDIGYDPDDFSRDPIMPT
QQ
Download sequence
Identical sequences K9PZJ3
WP_015134625.1.56710 gi|427724427|ref|YP_007071704.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]