SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427724571|ref|YP_007071848.1| from Leptolyngbya sp. PCC 7376

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427724571|ref|YP_007071848.1|
Domain Number 1 Region: 3-40
Classification Level Classification E-value
Superfamily PHP domain-like 0.00000108
Family PHP domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|427724571|ref|YP_007071848.1|
Sequence length 49
Comment PHP domain-containing protein [Leptolyngbya sp. PCC 7376]
Sequence
MSFVGLHIHSDYSLLDGASQIKPLVKRAQELNMPAITLMDLRILYEVIA
Download sequence
Identical sequences K9Q1R9
gi|427724571|ref|YP_007071848.1| WP_015134768.1.56710

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]