SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427724687|ref|YP_007071964.1| from Leptolyngbya sp. PCC 7376

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427724687|ref|YP_007071964.1|
Domain Number 1 Region: 7-66
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 8.05e-16
Family 7-Fe ferredoxin 0.0000704
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427724687|ref|YP_007071964.1|
Sequence length 81
Comment photosystem I iron-sulfur protein PsaC [Leptolyngbya sp. PCC 7376]
Sequence
MSHSVKIYDTCIGCTQCVRACPLDVLEMVPWDGCKAGQIASSPRTEDCVGCKRCETACPT
DFLSIRVYLGAETTRSMGLAY
Download sequence
Identical sequences A0A0D6APA3 A0A0X8WS26 A0A1E5QVU4 A0A1L9QRW4 A0A1Q2TYV0 A0A1Q4R0E3 A0A1U7HB64 A0A2G3PD04 K9Q084 K9YQA3 K9Z1N0 P31087
gi|428774508|ref|YP_007166296.1| WP_012307203.1.22074 WP_012307203.1.29953 WP_012307203.1.32705 WP_012307203.1.33663 WP_012307203.1.39416 WP_012307203.1.39551 WP_012307203.1.516 WP_012307203.1.52632 WP_012307203.1.53709 WP_012307203.1.56710 WP_012307203.1.57661 WP_012307203.1.61508 WP_012307203.1.62705 WP_012307203.1.62792 WP_012307203.1.72445 WP_012307203.1.76457 WP_012307203.1.8520 WP_012307203.1.97253 WP_012307203.1.99272 gi|170078198|ref|YP_001734836.1| 32049.SYNPCC7002_A1589 gi|428768739|ref|YP_007160529.1| gi|427724687|ref|YP_007071964.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]