SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427724730|ref|YP_007072007.1| from Leptolyngbya sp. PCC 7376

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|427724730|ref|YP_007072007.1|
Domain Number - Region: 149-189
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.00663
Family Di-heme elbow motif 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427724730|ref|YP_007072007.1|
Sequence length 217
Comment hypothetical protein Lepto7376_2921 [Leptolyngbya sp. PCC 7376]
Sequence
MAFIENWLTTIRTRTVAFIAIILAVAVTAVSCAGGTPEASAPAGIDPSKVADYIHTVLEA
DRTAYTKHVISRAKVLEGKEKEAGVLDVEATEGWQQTDGIPLPAQMFRLGSEIANEAGYF
TYNLISEWYINDNHAPKGDFEETALATMTETGEAVKDYQEIGGQKYYSAMYPDIAVAEAC
ATCHNTHPVHLERYPDKVFEVNDVMGGVVINIPLGDA
Download sequence
Identical sequences K9Q1A2
WP_015134924.1.56710 gi|427724730|ref|YP_007072007.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]