SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427724852|ref|YP_007072129.1| from Leptolyngbya sp. PCC 7376

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427724852|ref|YP_007072129.1|
Domain Number 1 Region: 1-158
Classification Level Classification E-value
Superfamily IpsF-like 1.7e-64
Family IpsF-like 0.00000499
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|427724852|ref|YP_007072129.1|
Sequence length 159
Comment 2-C-methyl-D-erythritol 2,4-cyclo diphosphate synthase [Leptolyngbya sp. PCC 7376]
Sequence
MNIRIGNGYDVHRLVAGRPLILGGIQLDHHLGLDGHSDADVLIHAIMDAMLGALSLRDIG
YYFPPSDPKWKGADSVKLLKQIDQLIKEKGWRIGNIDSVIVAERPKLKPHIPAMTKRLAE
ALDVELDQVGIKATTNEKLDATGKEQGICVHAVVLLIKD
Download sequence
Identical sequences K9Q0Q3
gi|427724852|ref|YP_007072129.1| WP_015135045.1.56710

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]