SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|427725292|ref|YP_007072569.1| from Leptolyngbya sp. PCC 7376

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427725292|ref|YP_007072569.1|
Domain Number 1 Region: 596-751
Classification Level Classification E-value
Superfamily beta-Roll 1.57e-23
Family Serralysin-like metalloprotease, C-terminal domain 0.0015
Further Details:      
 
Domain Number 2 Region: 1525-1712
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.57e-18
Family Pentraxin (pentaxin) 0.041
Further Details:      
 
Domain Number 3 Region: 1722-1853
Classification Level Classification E-value
Superfamily beta-Roll 0.00000000000102
Family Serralysin-like metalloprotease, C-terminal domain 0.001
Further Details:      
 
Domain Number 4 Region: 1292-1391
Classification Level Classification E-value
Superfamily beta-Roll 0.00000153
Family Serralysin-like metalloprotease, C-terminal domain 0.0018
Further Details:      
 
Domain Number 5 Region: 152-311
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.0000135
Family Matrix metalloproteases, catalytic domain 0.048
Further Details:      
 
Weak hits

Sequence:  gi|427725292|ref|YP_007072569.1|
Domain Number - Region: 1155-1272
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00298
Family delta-Endotoxin, C-terminal domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427725292|ref|YP_007072569.1|
Sequence length 1863
Comment hemolysin-type calcium-binding protein [Leptolyngbya sp. PCC 7376]
Sequence
MPAFNLTYDLNVTLEQRLAFEMAARIWATLLQDDVEINLHIGAIDGLNGNEAVGGAVPIF
HEVNYGVYQEYLANDATSEQDDSVVDALQEGNTVDVLIDADGDGTSEVVDGNTTIMLTRA
QAKALGMEDELLLDNGSTWDRDVLENPDALDGYIVINNSYDWSYDLTREDDVEEGQLDFL
TMALHEIGHSLGFVSGLDGLIESFEMYSGEIRTEGMTALDLLRYSETSVDVNNPDGTVSD
LTFGSDTYFSIDGGETSEANFEGGDDYQASHWQRLQNALGIMDPTLGYQERTDISELDLK
AFDVLGWDVDYGALSAGLDLDWLYQEAIAAISEDFKVGVDAVESALENGDDWYSLARGTW
WETFKSQMIDLGYGDWWEAFEAEAAALSPGGWWQQLDQQMLELGPGSWWQIFEDYAANLA
PGGWWQEFELAPGGWWQEFETAMWELSPGGWWQTFEPAMVEQSFGSVWQVFELQMESLGY
GAWWQQFEADLLGSGYDSWWDAFGEAILELGPGGWWQAFEDKVIELYPGGWWQQFEEDLV
ELVPGGWWLTPGGWWQAFELSPGGWWQQIEDYTRDVQSAEEVLNNLVGDDVETNSDQTMT
GGDNDDILAGGEGQDLINGKAGDDLIDGKGGNDIILAGKGNDIAYGAEGNDVVFGDEGDD
FIAGENGDDQIFGEAGHDILSGGRGADNISGGEGRDVLKGDTDDDVLDGGAGDDQLNGGS
GNDLAIGGTGQDIVLGGAGNDVLYGDNYLAPAEGGSDTDDSDGQPDDQPNSTIPVVTTAD
EAIANLGFWTRIEAEDMWLWKYKKEKVKDGELEASGDEFISTKWKGSATTTFNGADGIYD
FVLGYQDESNGIADITIMVWDGLWLKDSHTFYLSEATGAYTHKISGLNLESGDKIVIWGD
SDGDDEARIDYLDILTTGFTPNLDENGAPADGFYEVVGNQENIIQLEVEQMDLNSGAIIQ
SGEFASNGQYVSTNGDSTVVSDAYLTQVLGDLSQYSDAQLDYYRTLLAGSTSSSSSFGAT
SLFSGDTGYYDVVVGYYDTSNGTAEISIGIDNKEVDRWYSDESLGTTLVNSDALITRTVA
QGVYITYQDLIEIGATSHLGDSGNLDYIQFIEVEQPTETTEIVEQAPNVPETSGLPETIR
IEAEDTDKVQLSGKYRFESQSFASGGSLVRAKNSQGYTLTTEFTGTAGLYNIVIGYYDEN
DGESPVTVNLDGNQLDSWIFDQNLDSNLATANNFVTRTVGNAVSLENGSRLEIHANQESS
EFARIDYIEFIAVQETPEVTPAETDDDSGDSNNNDIIRGGDGDDIAYGGEGNDTIYGDAG
NDTLYGDTDGSVQNVAPVPTQTFTPTTLTFQQGINGYQGTVDTYVDEYYGSQVTGFGSAQ
TLLVDDNYGGFAVQSLLRFDDIFGGQSSQIDENDVVTSAILEIDLTYAGDRLMLHNMLQS
WSDNATWGSLGNGIQTNDVEAASTPIAIVENTANGTLQIDVTSSLQAWQADPAQNRGWVL
SSTGDEGVDFYSSESGYAPRLIVDVNQSSDSTPQTTDTPITNNFDGSNPVILDHTNDLLL
NNGTLSFNFNASSVSQKQGLFSKDSYGYDNGGHLTVYIKNGELVLRVQSTSQTYFLDTEI
SANQNYDVAITFGSNGLELWLDGVLEDTHSYTGGLGITSGGLGNYEPIVLGATQITSGDL
VADDVRDHFAGHLSDVRLYDQQLDSSSISLIPNNLVQTANIVFEALTSSQPNSLNGNDYL
IGGAGNDTLNGGGGNDILLGTDDVSLGANELDVLTGGSDSDTFILGDTESAYYSQGGDAD
YALITDFEIGTDHVNLSGLLEDYTLVSEGSDSLLYWQGEDLIARFSGGSNMTLSSTIFIV
SDP
Download sequence
Identical sequences K9Q1Y7
gi|427725292|ref|YP_007072569.1| WP_015135475.1.56710

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]