SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427725327|ref|YP_007072604.1| from Leptolyngbya sp. PCC 7376

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427725327|ref|YP_007072604.1|
Domain Number 1 Region: 27-148,178-366
Classification Level Classification E-value
Superfamily Pectin lyase-like 6.59e-24
Family Filamentous hemagglutinin FhaB, secretion domain 0.01
Further Details:      
 
Domain Number 2 Region: 374-637
Classification Level Classification E-value
Superfamily Pectin lyase-like 1.1e-18
Family Galacturonase 0.039
Further Details:      
 
Domain Number 3 Region: 577-771
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000000011
Family Galacturonase 0.015
Further Details:      
 
Domain Number 4 Region: 737-940
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000000004
Family Galacturonase 0.025
Further Details:      
 
Domain Number 5 Region: 1420-1556
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000847
Family Filamentous hemagglutinin FhaB, secretion domain 0.047
Further Details:      
 
Weak hits

Sequence:  gi|427725327|ref|YP_007072604.1|
Domain Number - Region: 1562-1683
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000191
Family Filamentous hemagglutinin FhaB, secretion domain 0.035
Further Details:      
 
Domain Number - Region: 1069-1179,1248-1256
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0226
Family iota-carrageenase 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427725327|ref|YP_007072604.1|
Sequence length 1998
Comment filamentous hemagglutinin family outer membrane protein [Leptolyngbya sp. PCC 7376]
Sequence
MKKNFAVGISIVAGWPIMLALQVQAQTLIPDNSLGSDSSTFSQVSAIRQEVSGGALRNNL
LLHSFQEFNVPEFKEVYFTNPNTVEYIFTRVTGVNTSVIDGTLGILGNANLFLINPNGIN
FGENASLDISGSFLASTAQEILTQESSFTNINAAIKDTLLTVNPEALFSNGLRNYLGDVT
NQGDLAVGIGQSLTLQGNNLFHQGLLTTETGSVNLLGNNVFLNDGEINVSGKNGGEIYLF
GANIVDVLEHSSLDASGQVNGGFIETSAPTVNVMGFINTHGETGLTGTWLLDPVDINIDA
SLANTISTKLNTNNVEISTAIGIDSAGDITLDATVSNLSSNSLTLTGRRFTRNSGNFNLG
GDLIFNLNQVNPETNTPSSSINAAISSIGMVQGDRLIRLGNGTFAGETLNINRDITIEAL
NPAVLMTDDNRVVIDVTPTVFLDGEDTRQVVNITSASANFNDIGIRQGNAIDGGGIANDF
GTVTLTNSFVSDNSAQDDGGGIVNDSGNIILTNSIVSNNSANDNAGGIDNTSGTVTLNNS
SISNNSSKDNGGGIDNSSGTVTLTNSSISGNSADANNAFGGGIANASGTVVSSNSNISGN
SAIYAGGIFNRNNGIVTLTTSVVSNNSAHSIGAGIYNRGTVAITNSTISGNSASGGGGIH
NGTTGIATLTNSIVSENSASGGGGGINNRGTLTLTTSTVSNNFVNAYNSSGGGIDNIFGT
VTITDSTVSNNSSGFIGGGIFNGFFGTVTLTDSIVSGNFANEDGGGIINIYGEVTLSNST
ITGNTANVSGGGIYNNETITLANSTVSDNSASFGGGIFNRYIVNLTDSTVSGNSSSNGGG
IFNAYYSTVDLADSTISGNSSLDGGGIFNSGEVTLSNSVFQENTDTDITNDSDGIVTLIG
DHIFKAFTEEGGIFKTQGRVSINDNLSFTLVNTNLIVSSPFELNALQLNFEDSFIDTSSF
IDGELNFTATDIMNFHGVIIRSNSNNLSLNLQSPSVAFLNSDITTSNSESGVSGVLNINS
SGNITLDNSRLFTTSEPGSTASGGDINFKANQLNLTNFSLIDTSTYSEGNAGNVDIISDN
LFLEDNSIVRSLTTNSGDAGNISLDIVGDVILNNRSVISTAATATSIGNSGDIKIGSVVN
PANTLILTNGSQLQALTEGNGNAGDIDIYIENDVVIDGFSELDLGDKPLTFTNIETSAPT
QILEQPSNENIASAQFLTDSDFQINNPNNANGNVEFSTRIPYSSIQATGDDNTVDIYAFE
VTAGTNIIFDIDAEAILFFYEDENEEDFTEFIQPNLKLTLLDSNGDLLLDSNNNPIGNDD
SFIGLGGSGSSNNFDPYLRHTFAETGTYYLRVAGTDDNAIRSVADRNSLNINDPLTTIFN
VSPQDRDLSRISDFKVSSIDDPTDSDFDSFELRLEDIGGNPRGVIFVPNENQIQYDLNIS
VETPLIEGLGGSVSDPTFPSGILTSTSGQGSAGEVNLHSATLQINEGGEISAKTSGAGDG
GTLNINSSQFIDLGDGFQHFEPVITVETSNAGRAGDININTPNFRLAETARITATATETA
TNLDGGGSININADVMDLAGTVGIFAETQGRSPAGSLRLQPFQQSLDLDINLFTDSQISA
STSGIGDGGDLVIAAPRNIEIRGAGSLSASTSGAGKGGTVRITSENLTLADGVTISTAST
NTGDAGDVVFEIAENLILQDSFVLANTTPESTGDGGTIDIDPLFTLLDNSTVAVSNLGTG
AGGNILLVSDILELRNGSNISAETLNAFGGNISLDVPTFLLMRNASNITASAGTVDSVGN
GGNIDIVTPFLVAFPNQDSNITANAFRGSGGNINIATNRLFGIAFTGENIPVRNDITVSS
VFGTDGIVTLNEGFDSTSGVAKLPEDLNDPRDQIDESCEIKNRNTFSVIGRGGLPNQEAE
ILSDELFWTDFRRGNSMQTPVAIPESSNLSLPMKRLAIAQGFERLPNGSIQLVAAGSPVT
IQAEQELPSHPSCVRAMH
Download sequence
Identical sequences K9Q224
WP_015135508.1.56710 gi|427725327|ref|YP_007072604.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]