SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427725359|ref|YP_007072636.1| from Leptolyngbya sp. PCC 7376

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427725359|ref|YP_007072636.1|
Domain Number 1 Region: 79-370
Classification Level Classification E-value
Superfamily Pectin lyase-like 2.42e-21
Family Filamentous hemagglutinin FhaB, secretion domain 0.011
Further Details:      
 
Domain Number 2 Region: 345-513
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000267
Family Filamentous hemagglutinin FhaB, secretion domain 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427725359|ref|YP_007072636.1|
Sequence length 838
Comment filamentous hemagglutinin family outer membrane protein [Leptolyngbya sp. PCC 7376]
Sequence
MATQRIEKSNCPIAALIFGGLCLQISGFSSMAIAQSMPPGVGSPPSITGITIDQNNTTNT
LIRNSIRGEPRDSIIIDQGLLSNNGANLFHSFGEFGISSNESVYFDAQGANRIISRVTGD
SASIINGSLNVLNDAMGGSDFYLLNPKGLSFGPDASLDLQGAFIGSTAEAIKFADNTVFS
AVSNHIPLLTVTAPIGLQFGQNPAPILLNQVNISLDEAQEFMLYGGDITLNGSDVNFGST
QNPVEILFVSVGEAGTVRLPNGINRTLTSIKSLGDLVNPAIARGDITITNGSIVNTLNGG
SLNFIGRNFALLENSQLFAPLDGAVDGGDIFFNFQNVRIEDSLIGLVTRNGSSGNGGSFI
VETKTFNLSDSLVTTDTLSDGNGGLIRIMASDFVRLVASGADTSQPVGLTSGTRVLNNVG
GDGDGGLVIVETKDLFIINGAQINTSTSTGGEGGRIFVNATGDVVLESSVERPSSIQSIS
NSDASNVGGGVKVLAKNLRVLDGSQISASTFSGANGGNVEVVVTEQALISGINTQLEDNT
QDSSFFFDRGILPSGIFSVSESSGDAGNVFFHAGESLITQGAQISVSNVVGGGAGSINIS
GDRLFADNSFIKAEASAGDDANINFDLSEFVFFSNENFVSSNAIGNATGGNITFNVGFLL
ASNNSDITANSANSEAGQVTVNATGVYGAVFREMRTPDSDITASSRLGVEFDGVVTLNVL
DVDPVSSVAKLPVTLNDPSNLITDRCDVARVNTFTTSGRGGIPTSPDNLLSADAWTDWRR
SPTMTSFTKHTPIVSTQSQSIRQVTKWERTPEGHIQLFAQREIENPWRSPEKKCRNSR
Download sequence
Identical sequences K9Q4W1
gi|427725359|ref|YP_007072636.1| WP_015135540.1.56710

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]