SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427725408|ref|YP_007072685.1| from Leptolyngbya sp. PCC 7376

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427725408|ref|YP_007072685.1|
Domain Number 1 Region: 1-92
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000000108
Family Cgl2762-like 0.078
Further Details:      
 
Domain Number 2 Region: 214-284
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.00000721
Family Retroviral integrase, catalytic domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|427725408|ref|YP_007072685.1|
Sequence length 290
Comment transposase [Leptolyngbya sp. PCC 7376]
Sequence
MPAPHSLDLRLKAVAAFDKGERKSDICRFFGISRNTLDLWLKRREKIGSVAPKTDYRRGP
QPKINDLDAFRAFAEEYGHLTQKEMAEKWPESISDASRREALRKIEFTRKKKTYRYQERD
KELEKAFVAQLKQYGQERLVYIDESGFDNTLDYGYGYCHKSERFIAEKLGHRTERVSVIG
GWREGEQIAPMVFEGYANSALVCQWVEDCLVPELIPGQIIILDNASVHPKERIQTLVAKA
GCEVIFLPPYSPHLNKIEKFWGRLKKEVSKLIKKTEDLFDAIRIAFCSMS
Download sequence
Identical sequences K9Q679
gi|427722629|ref|YP_007069906.1| gi|427724229|ref|YP_007071506.1| gi|427724643|ref|YP_007071920.1| gi|427725150|ref|YP_007072427.1| gi|427725408|ref|YP_007072685.1| gi|427725844|ref|YP_007073121.1| gi|427726174|ref|YP_007073451.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]