SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427725468|ref|YP_007072745.1| from Leptolyngbya sp. PCC 7376

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427725468|ref|YP_007072745.1|
Domain Number 1 Region: 17-168
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 0.0000000476
Family Type II DNA methylase 0.092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|427725468|ref|YP_007072745.1|
Sequence length 191
Comment MT-A70 family protein [Leptolyngbya sp. PCC 7376]
Sequence
MQQLLLDQPVVEGAQPFPAKAYGVIYADPPWQYEDKKKNRGGAERHYQTMSDHEIQNLPV
SQIAENDSLLFLWATWAKLPAALQTIHCWGFTYKTEAFLWVKRNKRAKSLFMGMGSYTRA
NSEFCLLGVRGKGLKRKSAKVHQIIEAPIRRHSEKPPETRERIVELVGDRPRIELFARET
VDGWDSWGDEL
Download sequence
Identical sequences K9Q448
gi|427725468|ref|YP_007072745.1| WP_015135646.1.56710

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]