SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427725509|ref|YP_007072786.1| from Leptolyngbya sp. PCC 7376

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427725509|ref|YP_007072786.1|
Domain Number 1 Region: 21-316
Classification Level Classification E-value
Superfamily Pectin lyase-like 6.75e-30
Family Filamentous hemagglutinin FhaB, secretion domain 0.0091
Further Details:      
 
Domain Number 2 Region: 990-1168
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000201
Family Filamentous hemagglutinin FhaB, secretion domain 0.058
Further Details:      
 
Domain Number 3 Region: 773-902
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000298
Family Filamentous hemagglutinin FhaB, secretion domain 0.048
Further Details:      
 
Domain Number 4 Region: 1206-1304
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000408
Family Filamentous hemagglutinin FhaB, secretion domain 0.054
Further Details:      
 
Domain Number 5 Region: 646-769
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000166
Family Filamentous hemagglutinin FhaB, secretion domain 0.065
Further Details:      
 
Domain Number 6 Region: 467-640
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000455
Family Filamentous hemagglutinin FhaB, secretion domain 0.062
Further Details:      
 
Weak hits

Sequence:  gi|427725509|ref|YP_007072786.1|
Domain Number - Region: 1316-1392
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0157
Family Filamentous hemagglutinin FhaB, secretion domain 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|427725509|ref|YP_007072786.1|
Sequence length 1643
Comment filamentous hemagglutinin family outer membrane protein [Leptolyngbya sp. PCC 7376]
Sequence
MKKKILLGASVFFSSVPYYQLSISAQIHPDNTLGIESSIVNQIDVNRYKISGGAQRLNNL
FHSFQDFNVPASGEVYFVPDKSVLNVLTRVTGNDPSEILGTLGVEGSSNLFLINSNGIYF
GSDASLDIAGSFTASTAESIPFTDGNNFSSTPTDGNELLSISVPLGVQFNSQPQSDITNK
GDLSVGIGQSLTFFGNTVLNSGSLTATGGTVMILGNRVGLIDQAEVDVSSNAGNGKVLIG
GDYQGLGTVPNATQTYVGPEVNIRADALADGHGGYVVIWADNITRFFGEISAQGGNNSGN
GGFVEVSGKRSLYFDGEVDTRAFNGQPGSLLLDPINITISVVAPAGFNTLTDEQDPVFDD
FFLAETEYGGQNIHLLPNTVGNLLRQNSLTLEAAETIQVNDSVTNDEIYDLTLRAPNINV
SGASLEQLGGGDIIVLTENLNIVAGGKLDTSTNNESDSGQIRVVATNALVDGVGSSITSQ
VNPGGTGNSGGIDIATTNLSVQNRGAISTTTTAGAQGNAGLVKITATGDIDVIGDGSDSP
LNSRIISQVNEGSGGSSGGIDITTENLDVRAGGKIDTSTGADGNAGLLKIAAGGNILVDG
LGSSIASQVNQGAVGSSNGINIATNNLSVQNQGIISASTANDAQGNAGLVIISATGNIDV
VGDNDPITNSDARIISQVNAGSEGNSGGIDITTGNLNLRAGGKVDTSTSSEGNAGLLKIA
AGGNILVDGLGSSIASQVDLGATGNSDGISITTNNLSVLNQGFISATTTAGAQGDAGVVT
ITAMGDINIIGDNDPATDPETIADSRIVSQVNVGSEGNSGGINITAGNLNVTGGGKVDTS
TGSEGNAGLLKIAAGGNILVDGLGSSIASQVDPGATGNSNGINISTNNLSVLNQGLISAT
TTNGAQGDAGVVTITATGDINVIGDDNPATDPETIADSRIISQVNVGSEGNSGGIDITAG
NLNVMGGGKVDTSTGSEGNAGLLKIATGGNILVDGLGSSIASQVNPGAAGNSEGININTN
NLSVQNRGLITATTTNAARGNAGLVKINAIADINIVGDNNPNTDPETFLDSRITSQVNEG
AKGNSGGIDIITANLNVRGGGKVDTSTGAQGNAGLLQIAARENILVSDLGSSIASQVNEG
ATGSSEGIDITTNNLSVRNRGLITATTTDGAQGNAGQLKISAMSDINVIGDNIPVVDPVR
DLDSRITSQVNEGSKGNSGGIDINTGNLNVLAGGKVDTSTGAEGNAGLLQIDATGNILVD
GIGSTIASQVNEGATGNSEGIDITTDTLSVFNKGAVSASTVDRGTAGSVTLRSRSNSNLL
ITLADNSVISATTNSPARGGDLTIEGTELVTIQGKGALTVESLSSDSGETGDVNVFANSV
VLDQGLELSARTASDFGGGNIILDVNDLVLLRRGSFINAESTSIANVSSGGNVDINTGFI
IALFNENSDIVANAVGGNGGNVSLTANRIFGLTPQNSFSTLELRNNTSSDASASSQLGIS
GNVTFLNLSFDPAQGLNELPGDLVDAEDLVGLHGCAVEQGEIAGGSELVVTGKGGLPVNP
NGNSSIPTATLDYLGNPKNIQVIATDIPHDSTPLSTTRIVTPEEIQLAKGWQRLPDGKIA
LVNQSSLQSSQNIPMHPDCMAKR
Download sequence
Identical sequences K9Q5B5
WP_015135685.1.56710 gi|427725509|ref|YP_007072786.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]