SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427725512|ref|YP_007072789.1| from Leptolyngbya sp. PCC 7376

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427725512|ref|YP_007072789.1|
Domain Number 1 Region: 430-571
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000000502
Family Filamentous hemagglutinin FhaB, secretion domain 0.035
Further Details:      
 
Domain Number 2 Region: 580-699
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000267
Family P22 tailspike protein 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|427725512|ref|YP_007072789.1|
Sequence length 1023
Comment filamentous hemagglutinin outer membrane protein [Leptolyngbya sp. PCC 7376]
Sequence
MTGDILTGNIEQYLYYGNNGNINLLTTVGDISTSEINQFLYHGDNGNINISTVTGNIQTD
NVIGGEINVFALSGDISMGQVNTSSENERFSDVLRNSNDLSISTLSGDILIESVNSSLDT
SELFEVPQFHPQIVKGGDINISTNTGSIFVGNILSFLLSNININGGGGNINLSTINGGIV
TGDVFSAAISSRGISRSNGGKISILTNIGDVKTGFISSDSIAATSSDSTIILDPDFDPNF
NPNFPNSNFFVVSPSGDAGDIQISTFNGDITSKAISASSFSLSDLVLYNLMMSGASFPLG
DSGNGGDIYLSIKEKGDISIVGSDRGFQGDLAPIVSSLLRSDALLTSSTFSTFGESGFGG
NIIIETPNILENVEILTLSSTSQSGAVSILGSNDLELNNIDVVTSKQLEIKLGSQPFEIK
FSVDLGGLGQSGNVLIESLGNINLIDSSITSESNSSKPAGNVNIISPKTITLARSSVISD
SNDFGDAGNIQFDTSTLNILEGSRVLAQTNGLGDGGTITINASSDVNLGRGVQDFSPILS
VETSGAGKAGDIIVNTPVLNVFDTARVTATATENSSSREGGGSIRLNSDQMNLRGEVGIF
AETQGESPAGILALKPYQNNLDLNVELFPNSKISASTSGSGRGGDLIVLAPRNIEISGAG
LLSAETSSTGDAGNINITSQNLTLSEDVTISTSTAGSGNAGNIKLTVAEDLNILNSKILS
SALPESSGNSGNIIIDPISTVLDNSDIAVSAQGNGIGGGIELISNRLSLINNSRLNAISD
RTDAGNINVFVPEYLFLTSDSNITTNSGDDGGNINIITPFIIALPNQDNNIVAEAIAGNG
GKINIFSKAYDSVSLFGIEFTGEDIALRNDISAKSDLGVDGEVLISLPEIDETAGLNELP
ADLVDAEDLVGLHGCAVEDEKIAGGSDLTLIGKGGLSNKPEGNVGISSPILIYLGNPDNI
QEIADSQTSPVAAQNSSVVPKTARGWQQLEDGTLLLTFDMPSSESQTVQNSLPKHPYCVA
QEN
Download sequence
Identical sequences K9Q2K5
WP_015135687.1.56710 gi|427725512|ref|YP_007072789.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]