SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|427725528|ref|YP_007072805.1| from Leptolyngbya sp. PCC 7376

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|427725528|ref|YP_007072805.1|
Domain Number 1 Region: 61-324
Classification Level Classification E-value
Superfamily Pectin lyase-like 3.61e-30
Family Filamentous hemagglutinin FhaB, secretion domain 0.0069
Further Details:      
 
Domain Number 2 Region: 527-715
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.00000102
Family Quinoprotein alcohol dehydrogenase-like 0.031
Further Details:      
 
Domain Number 3 Region: 1931-2028
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000942
Family Filamentous hemagglutinin FhaB, secretion domain 0.068
Further Details:      
 
Domain Number 4 Region: 2039-2143
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000942
Family Filamentous hemagglutinin FhaB, secretion domain 0.06
Further Details:      
 
Weak hits

Sequence:  gi|427725528|ref|YP_007072805.1|
Domain Number - Region: 683-860
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.00102
Family Quinoprotein alcohol dehydrogenase-like 0.029
Further Details:      
 
Domain Number - Region: 1788-1929
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00659
Family iota-carrageenase 0.093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|427725528|ref|YP_007072805.1|
Sequence length 2401
Comment filamentous hemagglutinin family outer membrane protein [Leptolyngbya sp. PCC 7376]
Sequence
MIKIHQSSKSNVWVASISLSLISLPVSAQSILDGTTPTDVLPNQMVQGDLAEYITGGFSL
NDSTIHSFSDFNVDVGQRVYFQNLVGIDNIITRVTGNNGSNIFGTLGVDGGANLFLINPN
GITFGAEASLDLRGSLFATTATDIELNDGSLLNISSAAPDALLSIDPNAIFPNALRNYQG
SIQSFADLTINESQSLSLVADVVEIDGSLTVPDGSIALFGNTVKLLDNADIATGDGSVEL
GDVASVEEKTAYVVNDGQISAQDIQVNARTLINYDSLDVSGETGGNIQTDVEYFSSSARG
EILADGSAGDGGRISIQADQSILFTADSIFSAQGKNHGGHIILDVGEKRNQLLSGTIDVS
GKTDIGGNVIITGDRLGIFGATIRADGMIGGGTVLVGGDYQGTGGLQRSSATTVGLDSLI
TANALINGDGGKVVLWSDGVTNFGGAIEAHGGELSGNGGLVEVSSLEGGHFAGIVEASAP
SGKAGSLLLDPQNITIADEILKGGWSLAQTFLNPSTTDSRVVEGSSSPVALDGDNILIGS
PTNDIEAQNAGSAYLFNTSGTLLQTYNNPTPAFSDRFGWDVAIDGNNVLIGELAFLGSTY
LFDTEGRLLQTFNNPTADPLLSSFGKSIALDGSNVLIGSPQETSSVGSAYLFNTNGTLLQ
TYNNPTPEEGDRFGSFVALDNRNVIISAPFDNTGAVSAGSTYLFDTSGTLLQTYNNPTPA
FLDRFGDGDIAIEGSKILIGSPYEDAGLAYLFNTSGTLLKTYNNPIPNPNFNSRFGQSVA
IDGSNILIGDPAGRLDKGIGFAYLFNIKGNLLRTYNNFTSGSRRFGQSVAIDGRNILIGA
RSDETGGNDVGAAYLYSLDIPNLFNEEPNGSFTFDADLITNTTNTGTNLTLQANNDITIN
EAILSNNLSGNGGDLLFQAGRSINVNADIFTDNGSLSLTANDTLANGVVKSERAPGVANL
IISSDVILDAGTGDIRLVLDDGKGLTHSDSGSVILSKTENLTQIKAQNLTVESSGSIAGT
SDLIIANDATFISRLAEAGTVNILTDDEPLTIGTSSIGGNLNITTEGTVNQAIGEPLQVA
GNISINGGGSDPLIKTLGDPSGEITLPNGDVIITQVGTVDLDAKTVAGNLTVNSIPEAVV
GFSGIFEDVAISLLGSNSFGGTVRFQTSLDDAVTISGTPGITQNGALDVAGTAQFNADIG
NINLSNPTNQFGNLGFIGNDVNITELNDSNFVSSIATGNFSFLSGGLITQSGGLDIDSNI
ELITTHPQAGNVELRNTLATSLSRSLIGGDFTLNSGGEITQVPGTSLQVAGALSLSPTVD
LSTFNLDGLIPRVITQANGDVIITDVGQVDLAGMTVNGNLTVNSLPELLDFNSTYNGENG
IILNANNAFSGNLKITTDADVIILESGIPGISQQDILNVDGTAAFNAENGIIDLNLDNNF
GQLGFFGEDVSITEASGINLISSFATGNLELTANDSITQSSSIQVQGTSKFTATDSPITL
NQANQFSDNISFNTSGDVIFTNTLSNTILGNSEIGGDFLITSTGDITQNAPQKNTGLTRF
YVGNGDINLPDDNDFNRISIDGGNNIFLNEITDIKIEESNVTDNLTVRALGNIKTDSIFS
PSGVIDLQSFAGDIDTTNGTLSTFSLGAGGRITLTADKGSVFLGDLNSSGFNFAGGDISI
LSPNGNIFVSGKTIGSNTFGNKRAGNVNFSGKFIQIDNESFVSVSTFSLGLGGTINIFDT
EEIHLLNGSRILSRAVNDGDAGSVKFDVQRLLIQNSTDKFTGIGADTARNVSGAGGKVDI
NASESVIIIGNQPGAFIPDTLSFSSILAAGEVNTGISSSTLGSSNAGNINLKTRTLIVKN
NAGIASAALNLTPDGGDAGSLSVTVNKFEAQGLAGLATTTIGAGDAGKLFLEANKLTLRD
GAVITADTIRGASGDANDVQINVAQLNLLDGSRIGAATANEGNGALIDISATESINIAGV
SPDPTIVSGIFSQALEDSTGAAGNIIIITPELRLDDRATIAASTDGSGPAGRIQINSLQT
FLGDSSSIQSTTSNGLGGKIFVAGNLLQATNGGQINTSTFGANPAGDIDIQIRDNITLTG
EGSGLFASTALGSTGDGGNIGIDPIRFNIFDGAAVAVDSDGSGIGGNVEIFANLLNLNKG
RISTETLSTDGGNLSLNIFDYILLENNSNITATAGTAFAGGNGGNINITTPFIIAMPGED
SNILSQAFAGNGGNILIKAFELFEIAFTGADIPTRNDINVSSVFGNEGTVDLSLPELDLT
SGVNELSGDLTDPSDRVASRCLGGRNISQNEFKVVNEGGHKPQPGGTYDVDQPFEDMGLA
PEQLTGNTLIESTVTESAGSMIPMVSSQGWQRVPGNKIQLIRTNHQNRILPLIHTSPLCK
S
Download sequence
Identical sequences K9Q4A2
WP_015135702.1.56710 gi|427725528|ref|YP_007072805.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]